DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tsp42En and Tsp96F

DIOPT Version :9

Sequence 1:NP_001260758.1 Gene:Tsp42En / 35624 FlyBaseID:FBgn0033135 Length:218 Species:Drosophila melanogaster
Sequence 2:NP_001262976.1 Gene:Tsp96F / 43127 FlyBaseID:FBgn0027865 Length:284 Species:Drosophila melanogaster


Alignment Length:260 Identity:65/260 - (25%)
Similarity:106/260 - (40%) Gaps:56/260 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 SFLKAVLIVLNVLLSLIGVTLIALSVYELNSSTPGTF----------EHIAIVVQIFVGTFVVLT 60
            |.:|.:::::|:|..|||:|::..||:.|   |..||          .|||:.|.:.:|..:.|.
  Fly     8 SCVKYLMVLINILFWLIGLTIVVTSVWML---TDPTFMLSMTQNYNHYHIALYVFLAIGILITLG 69

  Fly    61 SFLGCFATARVSLGLVWSYVICLLILLCLQIYIIA-AAHS----TDYVERSKKDFLATWADQRTN 120
            :|.||....|.|..|:.|:...:||::..||...| |.|:    .|.|..:.|..:.....|.|.
  Fly    70 AFFGCCGVCRESQCLLVSFFCVILIVMVAQIAAGAWAFHNKDKLDDIVRAAVKSSVQEEYGQSTM 134

  Fly   121 VER---ISLLEQKYSCCGQLGAHDY--------------------ILMGRGIPLSCYKDQ----- 157
            ..|   ...|::...|||..|..|:                    :.:...||.||.||.     
  Fly   135 SSRTVTFDTLQKNLKCCGADGPGDWATSRFNNVDRTNIVEIAVSSMNVFYNIPESCCKDNLKDNE 199

  Fly   158 ---ERR-------EYSLFSGGCLQAVQAHATDNVAIGLIIKWLLLLVEFAALGAATHLGITVRNK 212
               .||       ..:::..||:..:.....:|......:...::|:|..:|..|..|...|||:
  Fly   200 CELSRRLKFGGPLNNAIYQQGCVDKLIEIIYENWVTIFAVTAAVILLELLSLTFALSLCCAVRNQ 264

  Fly   213  212
              Fly   265  264

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tsp42EnNP_001260758.1 Tetraspannin 8..199 CDD:278750 58/243 (24%)
tetraspanin_LEL 96..180 CDD:239401 24/125 (19%)
Tsp96FNP_001262976.1 Tetraspannin 9..261 CDD:278750 61/254 (24%)
CD151_like_LEL 107..233 CDD:239408 23/125 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45443038
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3882
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR19282
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.