DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tsp42En and Tsp86D

DIOPT Version :9

Sequence 1:NP_001260758.1 Gene:Tsp42En / 35624 FlyBaseID:FBgn0033135 Length:218 Species:Drosophila melanogaster
Sequence 2:NP_001262468.1 Gene:Tsp86D / 41310 FlyBaseID:FBgn0037848 Length:316 Species:Drosophila melanogaster


Alignment Length:248 Identity:55/248 - (22%)
Similarity:98/248 - (39%) Gaps:61/248 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 TSFLKAVLIVLNVLLSLIGVTLIALSVY-------------ELNSSTPGTFEHIAIVVQIFVGTF 56
            :|.:|.::.:||.|..|.|..|:|:.||             .|::.....| :|::|: |..|..
  Fly    28 SSCVKYMIFLLNFLFWLFGGLLLAIGVYAFMDKLMDGNGWLRLDTIYDVIF-NISLVM-IIAGVI 90

  Fly    57 VVLTSFLGCFATARVSLGLVWSYVICLLILLCLQ-----IYIIAAAHSTDYVERSKKD-FLATWA 115
            |...||.||....|.:..|:..|.:|||:...|:     |..:...:...::|....| .:.::.
  Fly    91 VFTVSFAGCLGALRENTWLLKLYSMCLLLFFILEMSLAIICFVFPQYMNSFLEYQFTDKIIHSYR 155

  Fly   116 DQRTNVERISLLEQKYSCCGQLGA-------HDYILMGR------GIPLSC-------------- 153
            |.......|...:|:::|||...|       ::|.....      |:|.||              
  Fly   156 DDSDLQNFIDFAQQEFNCCGLSNAGYQDWSKNEYFNCSSPSVERCGVPYSCCINATDISSGLVNI 220

  Fly   154 ---YKDQER----REYSLFSGGCLQAVQAHATDN------VAIGLIIKWLLLL 193
               |..|.|    ....:::.||::.|:.....|      ||:|:.:..|.::
  Fly   221 MCGYGVQVRSVAAASKRIWTSGCIEIVRVWVERNLYVIAGVALGIALLQLFVI 273

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tsp42EnNP_001260758.1 Tetraspannin 8..199 CDD:278750 54/245 (22%)
tetraspanin_LEL 96..180 CDD:239401 20/118 (17%)
Tsp86DNP_001262468.1 Tetraspannin 51..283 CDD:278750 47/225 (21%)
penumbra_like_LEL 132..255 CDD:239411 20/122 (16%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45442909
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3882
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR19282
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.