DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tsp42En and Tsp66E

DIOPT Version :9

Sequence 1:NP_001260758.1 Gene:Tsp42En / 35624 FlyBaseID:FBgn0033135 Length:218 Species:Drosophila melanogaster
Sequence 2:NP_523985.1 Gene:Tsp66E / 39017 FlyBaseID:FBgn0035936 Length:267 Species:Drosophila melanogaster


Alignment Length:254 Identity:59/254 - (23%)
Similarity:101/254 - (39%) Gaps:61/254 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 DCRTSFLKAVLIVLNVLLSLIGVTL------IALSVYEL-------------NSSTPGTFEHIAI 47
            ||.....|.:|.:.|.:..::|..:      :|:..:.|             ..:.|...|.:|.
  Fly     4 DCGVWCAKYLLCIFNFIFFVLGTIIFGVGLWLAVDKHSLIALLKLVESERIEQFTQPQAIEQLAY 68

  Fly    48 VVQIFVGTFVVLTSFLGCFATARVSLGLVWSYVICLLILLCLQIYIIA---AAHSTDYVERSKKD 109
            |: :.:|..:...||||.....|.|..|:.:|...|::||..:  |:|   .|...|.|....|:
  Fly    69 VL-LVIGAVMFFMSFLGYLGAMRESRCLLSTYGTFLILLLIAE--IVAGGLGAFFKDKVRAESKN 130

  Fly   110 FLATWADQRT---NVERISL----LEQKYSCCGQLGAHDY-----ILMGRG---IPLSCY----- 154
            ||.|.....:   ||:..||    |...:.|||....||:     .:.|:|   ||.:|.     
  Fly   131 FLQTTITSYSLGENVDATSLMWNQLMGNFGCCGINDYHDFDASPAWVNGKGNRTIPDACCILKDV 195

  Fly   155 -----KDQE-----RREYSLFSGGCLQA-----VQAHATDNVAIGL-IIKWLLLLVEFA 197
                 :|::     ....|.:..||.:.     ::......|||.: |:..:|:::.||
  Fly   196 AKLVPRDEDCTTNPSDSNSFYKKGCYEVFTEWLIRQRELVIVAIAVGIVHLVLIILAFA 254

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tsp42EnNP_001260758.1 Tetraspannin 8..199 CDD:278750 57/248 (23%)
tetraspanin_LEL 96..180 CDD:239401 26/118 (22%)
Tsp66ENP_523985.1 Tetraspannin 9..258 CDD:278750 57/249 (23%)
uroplakin_I_like_LEL 116..231 CDD:239409 26/114 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45442973
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3882
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR19282
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.