DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tsp42En and TM4SF

DIOPT Version :9

Sequence 1:NP_001260758.1 Gene:Tsp42En / 35624 FlyBaseID:FBgn0033135 Length:218 Species:Drosophila melanogaster
Sequence 2:NP_001261159.1 Gene:TM4SF / 37786 FlyBaseID:FBgn0020372 Length:292 Species:Drosophila melanogaster


Alignment Length:238 Identity:51/238 - (21%)
Similarity:93/238 - (39%) Gaps:44/238 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 VLLSLIGVTLIALSVYELNSSTPGTFEHIAIV---------VQIFVGTFVVLTSFLGCFATARVS 72
            |||:|.|...|.|.    .|...|...:..||         :.:.:|....:..::||.||.:..
  Fly    19 VLLALTGAAQIFLG----TSLLWGHSVYYGIVQNKLWAPAAILLCLGPVTFILCWMGCQATNQRK 79

  Fly    73 LGLVWSYVICLLILLCLQIYI----IAAAHSTD-----YVERSKKDFLATWADQRTNVERISL-- 126
            ..|:..:...|:..:|:|..|    :|...:..     :::.|..:||..::  ||.|:.:.|  
  Fly    80 RCLLGMFAALLVACICVQFIICGWSLAMRENLPTSVEIFIDDSFVEFLDKFS--RTKVDNLHLWN 142

  Fly   127 -LEQKYSCCGQLGAHDYILMGRGIPLSCYKDQERREYSL----FSGGCLQAVQAHATDNVAIGLI 186
             ::.:..|||..|..||..:  .:|.||....|....|.    :..|||..|.....:.:.|...
  Fly   143 RMQSQLQCCGVDGPLDYRRL--SLPWSCCSRPEHAYESACDTHYKRGCLAVVSEQIRNRLLITAF 205

  Fly   187 IKWLLLLVEFAALGAATHLGI-----------TVRNKLRRERF 218
            ...::.:.:...:..|.||.|           .:..|.::::|
  Fly   206 GAAIIAIFQSLGIFCAVHLTILFGKNDNTHPMNMNRKKKQQQF 248

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tsp42EnNP_001260758.1 Tetraspannin 8..199 CDD:278750 45/206 (22%)
tetraspanin_LEL 96..180 CDD:239401 22/95 (23%)
TM4SFNP_001261159.1 Tetraspannin 9..224 CDD:278750 46/212 (22%)
uroplakin_I_like_LEL 111..197 CDD:239409 22/89 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3882
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR19282
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.