DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tsp42En and Tsp47F

DIOPT Version :9

Sequence 1:NP_001260758.1 Gene:Tsp42En / 35624 FlyBaseID:FBgn0033135 Length:218 Species:Drosophila melanogaster
Sequence 2:NP_725044.1 Gene:Tsp47F / 36230 FlyBaseID:FBgn0033629 Length:239 Species:Drosophila melanogaster


Alignment Length:259 Identity:54/259 - (20%)
Similarity:107/259 - (41%) Gaps:69/259 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 CRTSFLKAVLIVLNVLLSLIGVTLI---ALSVYELNSSTPGTFEHIA-------IVVQIFVGTFV 57
            |..|.:|.||...|||.::.|:.::   |:.:.::|.     |.|..       .:|.|..|..:
  Fly     4 CGPSLIKYVLFAFNVLFAISGLGILIAGAVVLADVNE-----FNHFVEGRVLAPPIVLIVTGLII 63

  Fly    58 VLTSFLGCFATARVSLGLVWSYVICLLILLCLQIYI-IAAA------------HSTDYVERSKKD 109
            .|.:.||||...:.|..|:.::.:.|.::..:::.: |||:            ...:.::||..:
  Fly    64 FLIASLGCFGAIKESPTLLITFAVLLAVIFIVELAVGIAASVFKKDLEGMVKNSLQESIKRSNSE 128

  Fly   110 FLATWADQRTNVERISLLEQKYSCCGQLGAHDY--ILMGRGIPLSCYKDQ--------------- 157
            ....|.:          ::||..|||.....|:  :...:.:|.||.:.|               
  Fly   129 DTMAWDN----------IQQKLMCCGVDSPADWRTLSANKTLPGSCCQPQYIDSTVGHCLESPAL 183

  Fly   158 ERREYSLFSGGCL----QAVQAHATDNVAIGLIIKWLLLLVEFAALGAATHLGITVRNKLRRER 217
            .:.:|  |..||:    ..::.:|...:.:|:.|.::.:|    .:..|.:|.    |.:|:||
  Fly   184 GKDKY--FQVGCVGKLKDRIEKNAIILIGVGIGIAFIQIL----GIVLACYLA----NSIRQER 237

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tsp42EnNP_001260758.1 Tetraspannin 8..199 CDD:278750 46/234 (20%)
tetraspanin_LEL 96..180 CDD:239401 19/116 (16%)
Tsp47FNP_725044.1 Tetraspannin 9..233 CDD:278750 49/248 (20%)
uroplakin_I_like_LEL 102..205 CDD:239409 19/114 (17%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45442935
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3882
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR19282
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.