DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tsp42En and lbm

DIOPT Version :9

Sequence 1:NP_001260758.1 Gene:Tsp42En / 35624 FlyBaseID:FBgn0033135 Length:218 Species:Drosophila melanogaster
Sequence 2:NP_001260757.1 Gene:lbm / 35623 FlyBaseID:FBgn0016032 Length:208 Species:Drosophila melanogaster


Alignment Length:219 Identity:68/219 - (31%)
Similarity:106/219 - (48%) Gaps:12/219 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MDCRTSFLKAVLIVLNVLLSLIGVTLIALSVYELNSSTPGTFEHIAIVVQIFVGTFVVLTSFLGC 65
            |.|.|:.:|...||||.:|..:....|....|..::.|    |...|...| ..:.:::.:.||.
  Fly     1 MGCATTSVKIASIVLNAVLGFLAAGAIGWIAYNADTET----EEFVIAAYI-ACSLILVFALLGI 60

  Fly    66 FATARVSLGLVWSYVICLLILLCLQIYIIAAAHSTDYVERSKKDFL-ATWADQRTNVERISLLEQ 129
            ||..|.|:.|..:..:.||||..||| :.......::..:|.:|.: ..|  |..|::.   |:|
  Fly    61 FAAIRESVVLTATSAVFLLILAILQI-VSTCLFLHEFDVKSGRDMVEVAW--QANNMDS---LQQ 119

  Fly   130 KYSCCGQLGAHDYILMGRGIPLSCYKDQERREYSLFSGGCLQAVQAHATDNVAIGLIIKWLLLLV 194
            |:.||||..|.|||.:...||.|||.|.::....|:..||::.||:....:....:|:.|:|:..
  Fly   120 KHECCGQSSAQDYIHLSLLIPPSCYADLQQTPDHLYLDGCIEKVQSFYESDKLRFIIVSWVLVAF 184

  Fly   195 EFAALGAATHLGITVRNKLRRERF 218
            |......|..|.|:.:||.||..|
  Fly   185 ELICFALAVFLAISFKNKQRRMEF 208

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tsp42EnNP_001260758.1 Tetraspannin 8..199 CDD:278750 57/191 (30%)
tetraspanin_LEL 96..180 CDD:239401 27/84 (32%)
lbmNP_001260757.1 Tetraspannin 8..198 CDD:278750 59/200 (30%)
tetraspanin_LEL <109..169 CDD:239401 25/64 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45467704
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3882
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0001737
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR19282
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.840

Return to query results.
Submit another query.