DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tsp42En and Tsp42Ek

DIOPT Version :9

Sequence 1:NP_001260758.1 Gene:Tsp42En / 35624 FlyBaseID:FBgn0033135 Length:218 Species:Drosophila melanogaster
Sequence 2:NP_001246161.1 Gene:Tsp42Ek / 35621 FlyBaseID:FBgn0033133 Length:215 Species:Drosophila melanogaster


Alignment Length:230 Identity:57/230 - (24%)
Similarity:109/230 - (47%) Gaps:33/230 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MDCRTSFLKAVLIVLNVLLSLIGVTLIALSVYELNSSTPGTFEHIAIVVQIF-VGTFVVLTSFLG 64
            |.|.:..:|..|..||.|.:|.|::|||::...| |..|     ||.::.:: :|..:.:::.||
  Fly     1 MGCTSGCVKCFLNTLNTLNALSGLSLIAIATLAL-SKAP-----IAYILFLYGLGGIIFVSAVLG 59

  Fly    65 CFATARVSLGLVWSYVICLLILLCLQIY-IIAAAHSTDYVER-SKKDFLATWADQRTNVERISLL 127
            |......::.:..:|...||..|.:.:. |.....:.:|:|: :.::....|.::......:.:.
  Fly    60 CCGICMENVCMTATYGFLLLAQLIISLLGIFRFKFTEEYIEKFAAEEVQMKWDEELVEPGAMDIY 124

  Fly   128 EQKYSCCGQLGAHDYILMGR-GIPLSCYKDQERREYSLFSGGCLQAVQ---------AHATDNVA 182
            :..|.|||:....||:.:|| .:|.||| .||..:...:..||:|...         ||.|:.:|
  Fly   125 QTVYECCGRDSPDDYVAIGRQTLPPSCY-PQEDPQMPHYLAGCVQKSSENFVVLFSYAHDTNWIA 188

  Fly   183 IGLIIKWLLLLVEFAALGAATHLGITVRNKLRRER 217
            :|:.|  |:::..|..:|           :.|::|
  Fly   189 LGITI--LMMIAAFYLVG-----------RFRKQR 210

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tsp42EnNP_001260758.1 Tetraspannin 8..199 CDD:278750 52/203 (26%)
tetraspanin_LEL 96..180 CDD:239401 23/94 (24%)
Tsp42EkNP_001246161.1 Tetraspannin 7..202 CDD:278750 52/203 (26%)
tetraspanin_LEL 94..174 CDD:239401 20/80 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3882
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0001737
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR19282
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.910

Return to query results.
Submit another query.