DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tsp42En and Tsp42Ej

DIOPT Version :9

Sequence 1:NP_001260758.1 Gene:Tsp42En / 35624 FlyBaseID:FBgn0033135 Length:218 Species:Drosophila melanogaster
Sequence 2:NP_523636.1 Gene:Tsp42Ej / 35620 FlyBaseID:FBgn0033132 Length:227 Species:Drosophila melanogaster


Alignment Length:207 Identity:48/207 - (23%)
Similarity:80/207 - (38%) Gaps:29/207 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 VLIVLNVLLSLIGVTL--IALSVYELNSSTPGTFEHIAIVVQIFVGTFVVLTSFLGCFATARVSL 73
            :::..||.....|||.  .|:|||....|.             ..|..|...:|||.:...:||.
  Fly    20 LIVTCNVFFFSCGVTTWGSAVSVYGSYGSA-------------LCGGAVFGVAFLGMYVALKVSY 71

  Fly    74 GLVWSYVICL-LILLCLQIYIIAAAHSTD-----YVERSKKDFLATWADQRTNV-ERISLLEQKY 131
            .....|:||. |::..|..|:.......:     :.||.:..|     :::|:. :::..:...:
  Fly    72 KYSIYYLICSGLVIAALGSYLFTFTAMREQLMGRFEERMRDLF-----ERKTHSDDKMQPVHSLF 131

  Fly   132 SCCGQLGAHDYILMGRG-IPLS-CYKDQERREYSLFSGGCLQAVQAHATDNVAIGLIIKWLLLLV 194
            .|||..|..||:....| :|.| ||.....:...::..||.....|.......:.......::.:
  Fly   132 GCCGIEGPQDYLQEEHGALPSSCCYAFDCSKPAHVYEEGCSTKAVATLRMQAELNYYSCMAIIAL 196

  Fly   195 EFAALGAATHLG 206
            ||..|..|.|||
  Fly   197 EFLGLFTAYHLG 208

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tsp42EnNP_001260758.1 Tetraspannin 8..199 CDD:278750 43/198 (22%)
tetraspanin_LEL 96..180 CDD:239401 18/91 (20%)
Tsp42EjNP_523636.1 Tetraspannin 11..211 CDD:278750 48/207 (23%)
tetraspanin_LEL 97..183 CDD:239401 18/90 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3882
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR19282
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.