DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tsp42En and Tsp42Ec

DIOPT Version :9

Sequence 1:NP_001260758.1 Gene:Tsp42En / 35624 FlyBaseID:FBgn0033135 Length:218 Species:Drosophila melanogaster
Sequence 2:NP_523629.1 Gene:Tsp42Ec / 35612 FlyBaseID:FBgn0033124 Length:232 Species:Drosophila melanogaster


Alignment Length:232 Identity:54/232 - (23%)
Similarity:101/232 - (43%) Gaps:41/232 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MDCRTSFLKAVLIVLNVLLSLIGVTLIALSVYEL----------NSSTPGTFEHIAIVVQIFVGT 55
            |.|.:..:..:|.::|::..::|:.||.|....|          :.:.|.|   |.|.|.: :|.
  Fly     1 MGCLSGIVNFILYIVNIVFLIVGILLIVLGSIMLSDLSRFDVAGSGTDPNT---IPICVTV-LGG 61

  Fly    56 FVVLTSFLGCFATARVSLGLVWSYVICLLILLCLQIYIIAAAHSTDYVERSKKDFLATWAD---- 116
            .:.:.||.||:...|.|:.:..:|...:.:|..||:.:      |.:|..::..||...::    
  Fly    62 LIFVVSFFGCYGIFRQSVCMTGAYTSMVFVLFILQLVL------TCWVFVNRSAFLGDMSNLVNL 120

  Fly   117 --QRTNVERISLLEQKYSCCGQLGAHDYILMGRGIPLSC--YKDQER--REYSLFSG--GCLQAV 173
              ...:...:.:||:.:.|||.....:|..:|..:|.:|  |.|::.  ...|::..  ||....
  Fly   121 LWDSHDYTAMGVLEETFGCCGDTSYTNYNNIGLSVPGTCCGYLDRQATCNTPSVYQSRPGCSAKF 185

  Fly   174 QAHATDNVAIGLIIKW------LLLLVEFAALGAATH 204
            :....||:.   ||:|      :..||.|...||.|:
  Fly   186 EEFWNDNMD---IIRWSGLGLCIFDLVVFLIAGALTN 219

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tsp42EnNP_001260758.1 Tetraspannin 8..199 CDD:278750 49/218 (22%)
tetraspanin_LEL 96..180 CDD:239401 18/95 (19%)
Tsp42EcNP_523629.1 Tetraspannin 7..221 CDD:278750 52/226 (23%)
tetraspanin_LEL 104..193 CDD:239401 17/88 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45467720
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3882
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0001737
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR19282
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.840

Return to query results.
Submit another query.