DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tsp42En and Tsp29Fb

DIOPT Version :9

Sequence 1:NP_001260758.1 Gene:Tsp42En / 35624 FlyBaseID:FBgn0033135 Length:218 Species:Drosophila melanogaster
Sequence 2:NP_001137809.1 Gene:Tsp29Fb / 34212 FlyBaseID:FBgn0032075 Length:308 Species:Drosophila melanogaster


Alignment Length:278 Identity:54/278 - (19%)
Similarity:95/278 - (34%) Gaps:97/278 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MDCRTSFLKAVLIVLN-------VLLSLIGVTL------IALSVYELNSSTPGTFEHIAIVVQIF 52
            |.|    .|.:||:::       :||.::|.|:      .:|.:....||.|        .:.|.
  Fly    12 MKC----AKYMLIIVSFMFALTAILLIMVGTTIQTIFGDFSLFIDGHFSSPP--------ALLIA 64

  Fly    53 VGTFVVLTSFLGCFATARVSLGLVWSYVICLLILLCLQIYIIAAA-----HSTDYVERSKKDFLA 112
            :|..::..:.||.:...:.|:.::..|.:||.::..|::....||     .....:.|:....||
  Fly    65 IGFILIAVAALGAYGAVKESVMVINLYGVCLFLVFILEVSAAIAAFVMQSQVRGMLIRTMNQALA 129

  Fly   113 TWADQRTNVERISLLEQKYSCCG-----------------QLGAHDYILMGRGIPLSCYKDQ--- 157
            .:.........:..::....|||                 .||..|.:     :|.||..:|   
  Fly   130 EYEHDPYVESGVDFMQSMLECCGVNEPEDWKDYLSANVNFTLGVDDVV-----VPNSCCGNQPTS 189

  Fly   158 ----------ERREYSLFSGGCLQAVQAHATDNVAIGLIIKWLLLLVEFAALGAAT-----HLGI 207
                      |..:|     ||.:          .:..|:....:|:   |.||.|     .||:
  Fly   190 LNDSTQMTCMETYDY-----GCFR----------KMNFIVSQSAMLI---ATGATTVAFVQLLGV 236

  Fly   208 TV---------RNKLRRE 216
            ..         |||..||
  Fly   237 LCAFMLAKTLRRNKSIRE 254

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tsp42EnNP_001260758.1 Tetraspannin 8..199 CDD:278750 41/238 (17%)
tetraspanin_LEL 96..180 CDD:239401 19/118 (16%)
Tsp29FbNP_001137809.1 Tetraspannin 14..246 CDD:278750 48/266 (18%)
tetraspanin_LEL 110..218 CDD:239401 18/127 (14%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3882
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR19282
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.