DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tsp42En and Tsp29Fa

DIOPT Version :9

Sequence 1:NP_001260758.1 Gene:Tsp42En / 35624 FlyBaseID:FBgn0033135 Length:218 Species:Drosophila melanogaster
Sequence 2:NP_001162915.1 Gene:Tsp29Fa / 34211 FlyBaseID:FBgn0032074 Length:248 Species:Drosophila melanogaster


Alignment Length:253 Identity:56/253 - (22%)
Similarity:100/253 - (39%) Gaps:70/253 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 LKAVLIVLNVLLSLIGVTLIALSV--------YELNSSTPGTFEHIAIVVQIFVGTFVVLTSFLG 64
            :|..|...|::..:.|:.|||:..        |:|  ...|.|..|...: |.:|:|:::.||.|
  Fly    11 VKYTLFGFNLIFLITGIILIAVGAGVGAVYTGYKL--FLAGKFFSIPTFL-IVIGSFIIIISFFG 72

  Fly    65 CFATARVSLGLVWSYVICLLILLCLQIYIIAAAHSTDYVERS-KKDFLAT--------------- 113
            |:...:.:..||.|:.:.|.|:..|::    ||..:.||.|: ..|.:.|               
  Fly    73 CWGALKENYCLVLSFSVMLAIIFILEL----AAGISGYVLRNDASDLIKTSLTYSLNEYNSINPN 133

  Fly   114 -----WADQRTNVERISLLEQKYSCCGQLGAHDYI--LMGRGIPLSC------------YKDQER 159
                 |.|          ::.::.|||....:|:|  .....:|:||            ..:.:.
  Fly   134 ATTKLWDD----------IQDEFECCGVTSYNDWITAFPNGDLPISCCNVHVGAVGTFTCNNAQS 188

  Fly   160 REYSLFSGGCLQA----VQAHATDNVAIGLIIKWLLLLVEFAALGAATHLG--ITVRN 211
            ........|||..    :.|||....|.|::|    .:::|..:..|.::.  |.:||
  Fly   189 SVADRHKVGCLDGFSGYISAHAVSLGAAGVVI----AILQFFGVIFACYIAREIKIRN 242

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tsp42EnNP_001260758.1 Tetraspannin 8..199 CDD:278750 52/237 (22%)
tetraspanin_LEL 96..180 CDD:239401 23/122 (19%)
Tsp29FaNP_001162915.1 Tetraspannin 11..238 CDD:278750 53/247 (21%)
tetraspanin_LEL 106..210 CDD:239401 19/113 (17%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45442990
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3882
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR19282
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.