DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tsp42En and Cd63

DIOPT Version :9

Sequence 1:NP_001260758.1 Gene:Tsp42En / 35624 FlyBaseID:FBgn0033135 Length:218 Species:Drosophila melanogaster
Sequence 2:XP_008763246.1 Gene:Cd63 / 29186 RGDID:62080 Length:262 Species:Rattus norvegicus


Alignment Length:228 Identity:56/228 - (24%)
Similarity:100/228 - (43%) Gaps:53/228 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 LKAVLIVLNVLL-----SLIGVTLIALSVYEL------NSSTPGTFEHIAIVVQIFVGTFVVLTS 61
            :|.|..:|.|||     ..:|:..|.::|..:      :.:|.|:   :..||.|.||.|:.|.:
  Rat    31 MKCVKFLLYVLLLAFCACAVGLIAIGVAVQVVLKQAITHETTAGS---LLPVVIIAVGAFLFLVA 92

  Fly    62 FLGCFATARVSLGLVWSYVICLLILLCLQIYIIAAAHSTDYVERS--KKDFLATWADQRTN---- 120
            |:||....:.:..|:.::.|.|.:::.:::.:..|.    ||.|.  |.:|..::..|..|    
  Rat    93 FVGCCGACKENYCLMITFAIFLSLIMLVEVAVAIAG----YVFRDQVKSEFSKSFQKQMQNYLTD 153

  Fly   121 ---VERISLLEQKYSCCGQLGAHDYILMGR-------GIPLSCYKD------QERREYSLFSGGC 169
               ...:..|:::..||   ||.:|....|       .:|.||..:      .:.:|.::.:.||
  Rat   154 NKTATILDKLQKENKCC---GASNYTDWERIPGMAKDRVPDSCCINITVGCGNDFKESTIHTQGC 215

  Fly   170 LQAVQAHATDNVAIGLIIKWLLLLVEFAALGAA 202
            ::.:.|....||          |||..||||.|
  Rat   216 VETIAAWLRKNV----------LLVAGAALGIA 238

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tsp42EnNP_001260758.1 Tetraspannin 8..199 CDD:278750 52/223 (23%)
tetraspanin_LEL 96..180 CDD:239401 22/105 (21%)
Cd63XP_008763246.1 Tetraspannin 33..255 CDD:278750 55/226 (24%)
ATP-synt_A <72..131 CDD:294288 17/65 (26%)
CD63_LEL 129..227 CDD:239419 21/100 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3882
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.