DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tsp42En and CG30160

DIOPT Version :9

Sequence 1:NP_001260758.1 Gene:Tsp42En / 35624 FlyBaseID:FBgn0033135 Length:218 Species:Drosophila melanogaster
Sequence 2:NP_724526.1 Gene:CG30160 / 246490 FlyBaseID:FBgn0050160 Length:222 Species:Drosophila melanogaster


Alignment Length:223 Identity:64/223 - (28%)
Similarity:99/223 - (44%) Gaps:39/223 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MDCRTSFLKAVLIVLNVLLSLIGVTLIALSVYELNSSTPGTF---------EHIAIVVQIFVGTF 56
            |:|.::..|.:|.:||::....|:.||.:....|  ||.|.|         :.|.|.: |.:|:.
  Fly     1 MNCLSAMFKYLLYLLNLVFVAGGILLIVVGSIML--STMGNFTAFDGGVNTQTIPICI-IVIGSV 62

  Fly    57 VVLTSFLGCFATARVSLGLVWSYVICLLIL----LCLQIYIIAAAHSTDYVERSKKDFLATWADQ 117
            ..:.:|.||..|.|.:......|.||:|||    |.|.|:|.||  :..::....|.....| |:
  Fly    63 TFVVAFFGCCGTIRENACCTTIYAICMLILFGLQLALSIWIFAA--NDKFLSSMGKAVDKAW-DE 124

  Fly   118 RTNVE--RISLLEQKYSCCGQLGAHDYILMGRGIPLSC--YKDQER-REYSLFS--GGCLQA--- 172
            ....:  .:..|:..:||||..|...|    ..:|.||  |||:.: .|..::|  .||.|.   
  Fly   125 NNAAQGYPMDALQLAFSCCGNTGYQQY----ETVPSSCCGYKDRTKVCEAEIYSQRPGCRQEFVD 185

  Fly   173 VQAHATDNVAIGLIIKWLLLLVEFAALG 200
            ..|..||      :|:|..|::....||
  Fly   186 FWASNTD------LIRWSSLIIALFELG 207

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tsp42EnNP_001260758.1 Tetraspannin 8..199 CDD:278750 60/213 (28%)
tetraspanin_LEL 96..180 CDD:239401 24/93 (26%)
CG30160NP_724526.1 Tetraspannin 8..219 CDD:278750 62/216 (29%)
tetraspanin_LEL 104..191 CDD:239401 24/93 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45467724
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3882
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0001737
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR19282
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.840

Return to query results.
Submit another query.