DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tsp42En and tsp-5

DIOPT Version :9

Sequence 1:NP_001260758.1 Gene:Tsp42En / 35624 FlyBaseID:FBgn0033135 Length:218 Species:Drosophila melanogaster
Sequence 2:NP_502621.3 Gene:tsp-5 / 192061 WormBaseID:WBGene00006631 Length:241 Species:Caenorhabditis elegans


Alignment Length:239 Identity:49/239 - (20%)
Similarity:99/239 - (41%) Gaps:51/239 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 VLIVLNVLLSLIGVTLIALSVYELNSSTPGTFEHIAIV----------------VQIFVGTFVVL 59
            :..:||:.|.::||.:...|::.:......|....::|                :.|.:|..:|:
 Worm    13 LFFILNLGLIVVGVIITWYSIWMVLHQFEVTVARTSLVNLLSVDNIECFYVYRTISIMIGGCMVV 77

  Fly    60 TSFLGCFAT-----ARVSLGLVWSYVICLLILLCLQIYIIAAAH-STDYVERSKKDFLATWADQR 118
            ..|.||||.     ..:|:.||..:::.::.::.:.:::....| ..::|...:.:.:|.:.:..
 Worm    78 LGFCGCFAVGFGSKTALSVHLVLVFIVFVVKIVAIVMFLANNDHLRREFVGVYRDELVANYHNNS 142

  Fly   119 TNVERISLLEQKYSCCGQLGAHDYILMGRGIPLSCYKDQE----RRE------YSLFSGGCLQAV 173
            .....:..:.....|||..|..|::..| ..|.||....:    |.|      :::|..|.||. 
 Worm   143 RTKNTLDWVHTSLKCCGANGCEDFLPAG-NFPTSCECGTKNAVVRMEGCALITWAVFEDGTLQV- 205

  Fly   174 QAHATDNVAIGLIIKWLLL-LVEFAALGAATHLGITVRNKLRRE 216
                   ..:|||...:.| |:.|||:         |.:::|||
 Worm   206 -------AFLGLICMLIELGLMIFAAI---------VIDRIRRE 233

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tsp42EnNP_001260758.1 Tetraspannin 8..199 CDD:278750 44/220 (20%)
tetraspanin_LEL 96..180 CDD:239401 18/94 (19%)
tsp-5NP_502621.3 Tetraspannin 11..223 CDD:278750 42/218 (19%)
tetraspanin_LEL 116..191 CDD:239401 14/75 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3882
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.