DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lbm and CD37

DIOPT Version :9

Sequence 1:NP_001260757.1 Gene:lbm / 35623 FlyBaseID:FBgn0016032 Length:208 Species:Drosophila melanogaster
Sequence 2:XP_005259492.1 Gene:CD37 / 951 HGNCID:1666 Length:365 Species:Homo sapiens


Alignment Length:272 Identity:61/272 - (22%)
Similarity:96/272 - (35%) Gaps:87/272 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 VKIASIVLNAVLGFLAAGAI----G-WIAYNADTETEEFVIAAYIACSL-----------ILVFA 56
            :|....|.|  |.|...|::    | ||..: .|....||..|::...:           .:..|
Human    11 IKYFLFVFN--LFFFVLGSLIFCFGIWILID-KTSFVSFVGLAFVPLQIWSKVLAISGIFTMGIA 72

  Fly    57 LLGIFAAIRESVVLTATSAVFLLILAILQI-----VSTCLFLHEFDVKSGRDMVEVAWQ------ 110
            |||...|::|...|.......||:|...||     :||.....|   :|.||:||...|      
Human    73 LLGCVGALKELRCLLGLYFGMLLLLFATQITLGILISTQRAQLE---RSLRDVVEKTIQKYGTNP 134

  Fly   111 -----ANNMDSLQQKHECCGQSSAQDYIHLSLL---------IPPSCY----------------- 144
                 ..:.|.:|.:..|||....||:..:.:|         :|.|||                 
Human   135 EETAAEESWDYVQFQLRCCGWHYPQDWFQVLILRGNGSEAHRVPCSCYNLSATNDSTILDKVILP 199

  Fly   145 --------------ADLQQTP--DHLYLDGCIEKVQSFYESDKLRFIIVSWVLVAFELICFALAV 193
                          ||:...|  .|:|.:||.:.:|.:..::.:..:.:...:...|:....|:|
Human   200 QLSRLGHLARSRHSADICAVPAESHIYREGCAQGLQKWLHNNLISIVGICLGVGLLEMTVMVLSV 264

  Fly   194 FLAISFKNKQRR 205
            .|       |||
Human   265 QL-------QRR 269

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lbmNP_001260757.1 Tetraspannin 8..198 CDD:278750 58/263 (22%)
tetraspanin_LEL <109..169 CDD:239401 21/112 (19%)
CD37XP_005259492.1 Tetraspannin 26..269 CDD:278750 54/253 (21%)
CD37_CD82_like_LEL 108..243 CDD:239413 29/137 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3882
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.