DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lbm and TSPAN18

DIOPT Version :9

Sequence 1:NP_001260757.1 Gene:lbm / 35623 FlyBaseID:FBgn0016032 Length:208 Species:Drosophila melanogaster
Sequence 2:XP_005253274.1 Gene:TSPAN18 / 90139 HGNCID:20660 Length:258 Species:Homo sapiens


Alignment Length:255 Identity:55/255 - (21%)
Similarity:95/255 - (37%) Gaps:69/255 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 GCATTSVKIASIVLN--AVLGFLAAGAIG-WIAYNADTETEEFVIA-------AYIACS---LIL 53
            |...:.:|....|.|  ..||.....||| |:..: .|...|.|.|       |||..:   |:.
Human    13 GDCLSCMKYLMFVFNFFIFLGGACLLAIGIWVMVD-PTGFREIVAANPLLLTGAYILLAMGGLLF 76

  Fly    54 VFALLGIFAAIRESVVLTATSAVFLLILAILQIVSTCL-------FLHEFDVK---------SGR 102
            :...||...|:||:..|.....:|:||:.:.::.:..|       ...||..|         :..
Human    77 LLGFLGCCGAVRENKCLLLFFFLFILIIFLAELSAAILAFIFRENLTREFFTKELTKHYQGNNDT 141

  Fly   103 DMVEVAWQANNMDSLQQKHECCGQSSAQDYIHLSLL---------IPPSCYADLQQTPDHLYL-- 156
            |:....|     :|:.....|||.:..:|:...|:.         :|.:|.....|:.|.:.|  
Human   142 DVFSATW-----NSVMITFGCCGVNGPEDFKFASVFRLLTLDSEEVPEACCRREPQSRDGVLLSR 201

  Fly   157 -------------DGCIEKVQSFYESDKLRFIIVSWVL----VAFEL--ICFALAVFLAI 197
                         .||...:.:.:|:    ::.::..|    :|.||  :.||:.:|..|
Human   202 EECLLGRSLFLNKQGCYTVILNTFET----YVYLAGALAIGVLAIELFAMIFAMCLFRGI 257

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lbmNP_001260757.1 Tetraspannin 8..198 CDD:278750 54/249 (22%)
tetraspanin_LEL <109..169 CDD:239401 14/83 (17%)
TSPAN18XP_005253274.1 Tetraspannin 20..253 CDD:395265 52/242 (21%)
uroplakin_I_like_LEL 115..228 CDD:239409 19/121 (16%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3882
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.