DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lbm and Cd82

DIOPT Version :9

Sequence 1:NP_001260757.1 Gene:lbm / 35623 FlyBaseID:FBgn0016032 Length:208 Species:Drosophila melanogaster
Sequence 2:NP_113985.2 Gene:Cd82 / 83628 RGDID:69070 Length:266 Species:Rattus norvegicus


Alignment Length:261 Identity:57/261 - (21%)
Similarity:98/261 - (37%) Gaps:80/261 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 GCATTSVKIASIVL---NAVLGFLAAGAIG---WIAYNAD---------TETEEFVIAAYI---A 48
            ||    ||:....|   |.:...|.|..:|   ||.  ||         |.:....:.||:   .
  Rat     4 GC----VKVTKYFLFLFNLLFFILGAVILGFGVWIL--ADKSSFISVLQTSSSSLQVGAYVFIGV 62

  Fly    49 CSLILVFALLGIFAAIRESVVLTATSAVFLLILAILQIVSTCLFLHEFD---VKSGRDMVEV--- 107
            .::.::...||...|:.|...|.....||||::.|.|:....||....|   .:.|..::::   
  Rat    63 GAITMLMGFLGCIGAVNEVRCLLGLYFVFLLLILIAQVTVGVLFYFNADKLKQEMGNTVMDIIQN 127

  Fly   108 -----------AWQANNMDSLQQKHECCGQSSAQDYIHLSLL-------IPPSCYADLQQ----- 149
                       ||     |.:|.:.:|||..|..::....:|       .|.||....::     
  Rat   128 YSVNASSSREEAW-----DYVQAQVKCCGWVSPSNWTRNPVLKNSTKTTYPCSCEKTKEEDNQLI 187

  Fly   150 ----------------TPDH--LYLDGCIEKVQSFYESDKLRFIIVSWVLVAFELICFALAVFLA 196
                            :|:.  ::.:||:||.|::.:.:   |.|:..|.....:| ..|.:||:
  Rat   188 VKKGFCESDNSTASENSPEDWPVHPEGCMEKAQAWLQEN---FGILLGVCAGVAVI-ELLGLFLS 248

  Fly   197 I 197
            |
  Rat   249 I 249

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lbmNP_001260757.1 Tetraspannin 8..198 CDD:278750 55/255 (22%)
tetraspanin_LEL <109..169 CDD:239401 17/89 (19%)
Cd82NP_113985.2 Tetraspannin 24..255 CDD:278750 50/237 (21%)
CD37_CD82_like_LEL 106..228 CDD:239413 21/129 (16%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3882
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.