DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lbm and TSPAN4

DIOPT Version :9

Sequence 1:NP_001260757.1 Gene:lbm / 35623 FlyBaseID:FBgn0016032 Length:208 Species:Drosophila melanogaster
Sequence 2:XP_011518638.1 Gene:TSPAN4 / 7106 HGNCID:11859 Length:269 Species:Homo sapiens


Alignment Length:226 Identity:49/226 - (21%)
Similarity:89/226 - (39%) Gaps:50/226 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 KIASIVLNAVLGFLAAGAIG---WIAYNAD---TETEEF--VIAA---YIACSLILVFALLGIFA 62
            ::.|.:..|.||  ..|.:|   |:|....   |.:..|  :.||   .|..:.::....:|...
Human    43 RLVSFLWPAQLG--GCGVLGVGIWLAATQGSFATLSSSFPSLSAANLLIITGAFVMAIGFVGCLG 105

  Fly    63 AIRESVVLTATSAVFLLILAILQIVSTCLFL---------HEFDVKSGRDM--------VEVAWQ 110
            ||:|:..|..|..:.||::.:|:.....||.         .:.|:|.|..:        :..||.
Human   106 AIKENKCLLLTFFLLLLLVFLLEATIAILFFAYTDKIDRYAQQDLKKGLHLYGTQGNVGLTNAWS 170

  Fly   111 ANNMDSLQQKHECCGQSSAQDY--IHLSLLIPPSCYADLQQT-----PDHLYLDGCIEKVQSFYE 168
            .     :|....|||.|:..|:  ::.:..:|.||..:..::     |...:...|.|.|:.:.:
Human   171 I-----IQTDFRCCGVSNYTDWFEVYNATRVPDSCCLEFSESCGLHAPGTWWKAPCYETVKVWLQ 230

  Fly   169 SDKLRFIIVSWVLVAFELICFALAVFLAISF 199
            .:.|...|..        :|.||...|.::|
Human   231 ENLLAVGIFG--------LCTALVQILGLTF 253

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lbmNP_001260757.1 Tetraspannin 8..198 CDD:278750 48/223 (22%)
tetraspanin_LEL <109..169 CDD:239401 14/66 (21%)
TSPAN4XP_011518638.1 Tetraspannin 63..261 CDD:278750 43/204 (21%)
NET-5_like_LEL 136..233 CDD:239418 18/101 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3882
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.