DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lbm and upk1a

DIOPT Version :9

Sequence 1:NP_001260757.1 Gene:lbm / 35623 FlyBaseID:FBgn0016032 Length:208 Species:Drosophila melanogaster
Sequence 2:NP_001035332.1 Gene:upk1a / 678515 ZFINID:ZDB-GENE-060421-2603 Length:250 Species:Danio rerio


Alignment Length:256 Identity:52/256 - (20%)
Similarity:91/256 - (35%) Gaps:85/256 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MGCATTSVKIASIVLNAVLGF--LAAGAIG-WIA--------YNADTETEEFVIAAYIACSLILV 54
            || |.|.:.:..:.|||:...  ||..|:. |:|        .:..:..::....|:||......
Zfish     1 MG-AVTCLMVTVVGLNAIAAAAGLALSAVAIWVAVDGYKLYPISGVSGKDDIFAGAWIAIFTGFA 64

  Fly    55 F---ALLGIFAAIRESVVLTATSAVFLLILAIL----------------------QIVSTCLFLH 94
            |   .:.|||||::.|   .|...|:|:|:.|:                      .:|...:..:
Zfish    65 FFLTCIFGIFAALKRS---RALMLVYLIIMFIIFLFESASAITSATNRDYLVGNSNLVKKQMLQY 126

  Fly    95 EFDVKSGRDMVEVAWQANNMDSLQQKHECCGQSSAQDYI-------------------------- 133
            ..|..:....:.:.|. |.|..:|    |||.....|:|                          
Zfish   127 YADSSTQGQQITMTWN-NVMTQVQ----CCGADGPTDWIQYNSTYRQLFGAASLWPLGCCKRQSS 186

  Fly   134 HLSLLIPPSCYADLQQTPDHLYLDGCIEKVQSFYESDKLRFI-IVSW------VLVAFELI 187
            :..::.|..|.|.:..:   ::..||.:.::|...    |:. .|||      :||.|.|:
Zfish   187 NFEVVDPIGCKAGVTSS---MFTQGCFQYIESVLS----RYTWAVSWYGFSVLMLVFFTLV 240

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lbmNP_001260757.1 Tetraspannin 8..198 CDD:278750 48/249 (19%)
tetraspanin_LEL <109..169 CDD:239401 15/85 (18%)
upk1aNP_001035332.1 Tetraspannin 30..246 CDD:278750 42/226 (19%)
uroplakin_I_like_LEL 103..221 CDD:239409 18/129 (14%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3882
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.