DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lbm and tspan37

DIOPT Version :9

Sequence 1:NP_001260757.1 Gene:lbm / 35623 FlyBaseID:FBgn0016032 Length:208 Species:Drosophila melanogaster
Sequence 2:NP_001292501.1 Gene:tspan37 / 564334 ZFINID:ZDB-GENE-070912-550 Length:245 Species:Danio rerio


Alignment Length:183 Identity:36/183 - (19%)
Similarity:69/183 - (37%) Gaps:50/183 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    50 SLILVF-ALLGIFAA----IRESVVLTATSA---------VFLLILAILQIVSTCLFLHEFDVKS 100
            :|.::| |||.:.:.    |..|:....:|.         |:.||:....:.:|....:.:..|.
Zfish    45 NLYIIFPALLAVVSGAILFITGSIGCLVSSKKPSCGHGLFVYFLIIVFCVVGTTAALAYFYQGKL 109

  Fly   101 GRDMVEV--AWQ--ANN--------MDSLQQKHECCGQSSAQDYIHLSLL-------IPPSC--- 143
            ..::..:  .:|  :||        :|.||.:.:|||..:..|::.....       :|.||   
Zfish   110 DAELAPLKDVFQNYSNNSQDPDTKAVDRLQSELQCCGVMNYTDWLQTPWFNHSGKYDVPQSCCNT 174

  Fly   144 -YADLQQT---PDHLYLDGCIEKVQSFY----------ESDKLRFIIVSWVLV 182
             :.....|   |..||.:.|..|::...          ....|..:::||:.|
Zfish   175 TFHSCNGTLDAPMLLYNEACQVKLKELLLLVVHIIHITSLVVLVLLVLSWITV 227

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lbmNP_001260757.1 Tetraspannin 8..198 CDD:278750 36/183 (20%)
tetraspanin_LEL <109..169 CDD:239401 19/93 (20%)
tspan37NP_001292501.1 Tetraspannin 14..194 CDD:278750 30/148 (20%)
TM4SF8_like_LEL 102..195 CDD:239416 18/92 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3882
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.