DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lbm and tspan4b

DIOPT Version :9

Sequence 1:NP_001260757.1 Gene:lbm / 35623 FlyBaseID:FBgn0016032 Length:208 Species:Drosophila melanogaster
Sequence 2:NP_001076276.1 Gene:tspan4b / 556934 ZFINID:ZDB-GENE-070410-127 Length:232 Species:Danio rerio


Alignment Length:229 Identity:55/229 - (24%)
Similarity:92/229 - (40%) Gaps:49/229 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 GCATTSVKIASIVLNAVLGFLAAGAIG---WIAYNADTETE--------EFVIAA---YIACSLI 52
            || ...||....|.|.:......|..|   |:|:   |::|        ..:.||   .:|..:.
Zfish     6 GC-LCCVKYLMFVFNLIFWLGGCGLFGVGVWLAF---TQSEFSSLPLSFPSLSAANLLLVAGGVT 66

  Fly    53 LVFALLGIFAAIRESVVLTATSAVFLLILAILQIV---STCLFLHEFDVKSGRDMVE--VAWQAN 112
            :|...||...|::|...|..|..|.||||.:.::|   ...|:..|.|.|:..|:.|  ..:..|
Zfish    67 MVTGFLGCLGALKEQKCLLLTFFVILLILVLTEVVLILVLSLYHEELDKKAKDDLREGMKGYSKN 131

  Fly   113 -----NMDSLQQKHECCGQSSAQDYIHLSL--LIPPSCYADLQQTPDHLYLDGCIEKVQSFYESD 170
                 :.|::|...:|||.|:..|:.:.:.  .:|.||.::...:..| :.:.|.||.:      
Zfish   132 DGLRKSWDNMQMIFKCCGVSNHTDWHNKTTDGKLPGSCCSNDPSSCRH-WEEPCYEKAK------ 189

  Fly   171 KLRFIIVSWVLVAFEL-----ICFALAVFLAISF 199
                   .|:|.....     :|..:...||:.|
Zfish   190 -------QWLLTNITSVLGFGVCIGIVQLLALVF 216

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lbmNP_001260757.1 Tetraspannin 8..198 CDD:278750 52/220 (24%)
tetraspanin_LEL <109..169 CDD:239401 15/66 (23%)
tspan4bNP_001076276.1 Tetraspannin 10..224 CDD:278750 53/224 (24%)
NET-5_like_LEL 108..196 CDD:239418 23/101 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3882
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.