DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lbm and tspan9a

DIOPT Version :9

Sequence 1:NP_001260757.1 Gene:lbm / 35623 FlyBaseID:FBgn0016032 Length:208 Species:Drosophila melanogaster
Sequence 2:XP_009291748.1 Gene:tspan9a / 555341 ZFINID:ZDB-GENE-060503-632 Length:336 Species:Danio rerio


Alignment Length:243 Identity:50/243 - (20%)
Similarity:98/243 - (40%) Gaps:51/243 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 GCATTSVKIASIVLNAVLGFLAAGAIG---WIAYNADT-----------ETEEFVIAAYIACSLI 52
            || ...:|....|.|.:......|.:|   |::.:..:           .....|||   ..:::
Zfish   101 GC-LCCLKYMMFVFNLIFWLCGCGLLGVGIWLSVSQGSFATFSPSFPSLSAANMVIA---IGAIV 161

  Fly    53 LVFALLGIFAAIRESVVLTATSAVFLLILAILQIVSTCLFL---------HEFDVKSGRDMVEV- 107
            :|...||...||:|:..|..:..:.|||:.:.:::...||.         .:.|:|.|..:... 
Zfish   162 MVTGFLGCLGAIKENKCLLLSFFIVLLIILLAELILLILFFVYSDKVSENAKQDLKDGLALYNTD 226

  Fly   108 -------AWQANNMDSLQQKHECCGQSSAQDYIHLSL---LIPPSCYADLQQ-----TPDHLYLD 157
                   ||     :.:|.:.:|||.:...|: |.:|   ::|..|..:..|     :.:..:..
Zfish   227 NNIGLRNAW-----NIIQAEWKCCGVTGYTDW-HDALKEKVVPDRCCQEHYQECGRNSTNMFWTR 285

  Fly   158 GCIEKVQSFYESDKLRFIIVSWVLVAFELI--CFALAVFLAISFKNKQ 203
            ||.|||:.:.|.:|.....:...::..:|:  .|::.:|..|....|:
Zfish   286 GCYEKVEEWLEDNKHLLGTIGMCILVVQLLGMAFSMTLFHQIHRSGKK 333

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lbmNP_001260757.1 Tetraspannin 8..198 CDD:278750 46/230 (20%)
tetraspanin_LEL <109..169 CDD:239401 16/67 (24%)
tspan9aXP_009291748.1 Tetraspannin 105..327 CDD:278750 46/230 (20%)
NET-5_like_LEL 202..299 CDD:239418 21/102 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3882
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.