DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lbm and tspan18b

DIOPT Version :9

Sequence 1:NP_001260757.1 Gene:lbm / 35623 FlyBaseID:FBgn0016032 Length:208 Species:Drosophila melanogaster
Sequence 2:XP_005159229.1 Gene:tspan18b / 436712 ZFINID:ZDB-GENE-040718-137 Length:258 Species:Danio rerio


Alignment Length:253 Identity:52/253 - (20%)
Similarity:98/253 - (38%) Gaps:67/253 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 GCATTSVKIASIVLNAVL---GFLAAGAIGWIAYNADTETEEFVIA-------AYIACS---LIL 53
            |...:.:|....|.|.::   |....|...|:..: .|...|.|.|       .||..:   ::.
Zfish    15 GDCLSCIKYLMFVFNFLIFLGGSFLLGVGVWVVVD-PTGFREIVAANPLLFTGVYIILAMGGMLF 78

  Fly    54 VFALLGIFAAIRESVVLTATSAVFLLILAILQIVSTCL-------FLHEFDVK---------SGR 102
            :...||...||||:..|.....:.:||:.:.::.:..|       ...|:..|         :..
Zfish    79 LLGFLGCCGAIRENKCLLLFFFMLILIIFLAELAAAILAFIFREHLTREYFTKELKKHYQGYNNT 143

  Fly   103 DMVEVAWQANNMDSLQQKHECCGQSSAQDY-------IHLSLLIPPSC-----------YADLQQ 149
            |:....|.|     :....:|||.:|.:|:       |:.|.::|.:|           :::.::
Zfish   144 DVFTSTWNA-----IMNTFDCCGVNSPEDFEESIFRIINPSEMVPEACCRRNNHVGESGFSNREE 203

  Fly   150 --TPDHLYLD--GCIEKVQSFYESDKLRFIIVSW----VLVAFEL--ICFALAVFLAI 197
              :...||.:  ||...|..::|    .:|.|:.    |::..||  :.||:.:|..|
Zfish   204 CLSGSMLYRNNKGCYSAVVDYFE----MYIYVAGALAIVVLTIELFAMVFAMCLFRGI 257

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lbmNP_001260757.1 Tetraspannin 8..198 CDD:278750 51/247 (21%)
tetraspanin_LEL <109..169 CDD:239401 16/81 (20%)
tspan18bXP_005159229.1 Tetraspannin 20..257 CDD:278750 50/246 (20%)
uroplakin_I_like_LEL 118..229 CDD:239409 20/119 (17%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3882
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.