DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lbm and Tsp97E

DIOPT Version :9

Sequence 1:NP_001260757.1 Gene:lbm / 35623 FlyBaseID:FBgn0016032 Length:208 Species:Drosophila melanogaster
Sequence 2:NP_001263002.1 Gene:Tsp97E / 43241 FlyBaseID:FBgn0039465 Length:228 Species:Drosophila melanogaster


Alignment Length:220 Identity:58/220 - (26%)
Similarity:99/220 - (45%) Gaps:36/220 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 CATTSVKIASIVLNAVLGFLAAGAIGWIAYNADTETEEFVIAAYIACSLILV-FALLGIFAAIRE 66
            |:..:: ||..:|..::|||..| :|..|..|...|...::...:||.:||: .::||:..|::.
  Fly     7 CSKNAL-IALNILYVMIGFLLIG-VGVYARAASIVTNLPIVGGILACGVILICISMLGLAGAVKH 69

  Fly    67 SVVLTATSAVFLLILAILQ--IVSTCLFLHEFDVKSGRDMVEVAWQANNMD---SLQQKHECCGQ 126
            ..|:.....:.|.:|.::|  |.|:||.::.   :..:...|..|.....|   .:|...:|||.
  Fly    70 HQVMLFFYMIILFMLFLIQFSIASSCLAVNS---EQQQQFAEQGWMTVPTDLRKQVQDSLKCCGF 131

  Fly   127 SSAQDYIHLSLLIP----PSCYADLQQTPDHLYLDGC-IEKVQSFYESDKLRFIIVSWVLVAFEL 186
            ::...  ..:.::|    |||....||...|.....| .|......| ||:.:        ||:|
  Fly   132 NATAP--STTSVVPPSNEPSCELINQQCCAHSSEPDCRCEPCGPLLE-DKIDY--------AFKL 185

  Fly   187 -----ICFA----LAVFLAISFKNK 202
                 |.|:    ||||||..::|:
  Fly   186 CGGLGIFFSFTEVLAVFLARRYRNQ 210

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lbmNP_001260757.1 Tetraspannin 8..198 CDD:278750 56/209 (27%)
tetraspanin_LEL <109..169 CDD:239401 15/67 (22%)
Tsp97ENP_001263002.1 Tetraspannin 7..204 CDD:278750 55/212 (26%)
tetraspanin_LEL <121..177 CDD:243179 14/58 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45442872
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3882
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR19282
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.930

Return to query results.
Submit another query.