DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lbm and tspan9b

DIOPT Version :9

Sequence 1:NP_001260757.1 Gene:lbm / 35623 FlyBaseID:FBgn0016032 Length:208 Species:Drosophila melanogaster
Sequence 2:NP_001002186.1 Gene:tspan9b / 431733 ZFINID:ZDB-GENE-040704-25 Length:239 Species:Danio rerio


Alignment Length:230 Identity:50/230 - (21%)
Similarity:97/230 - (42%) Gaps:43/230 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 GCATTSVKIASIVLNAVLGFLAAGAIG---WIAYNAD---TETEEF--VIAAYIAC---SLILVF 55
            || ...||....:.|.:......|.:|   |::.:..   |.:..|  :.||.:..   |:::|.
Zfish     4 GC-LCCVKYMMFLFNLLFWLSGCGLLGVGIWLSVSQGSFATFSPSFPSLSAANLVITLGSVVMVT 67

  Fly    56 ALLGIFAAIRESVVLTATSAVFLLILAILQIVSTCLFL---------HEFDVKSGRDMVEV---- 107
            ..||...||:|:..|..:..:.|||:.:.:::...||.         .:.|:|.|..:...    
Zfish    68 GFLGCLGAIKENKCLLLSFFIVLLIILLAELILLILFFVYTEKVSENAKQDLKDGLRLYNTDNNV 132

  Fly   108 ----AWQANNMDSLQQKHECCGQSSAQDYIHLSL---LIPPSC----YADL-QQTPDHLYLDGCI 160
                ||     :.:|.:.:|||.:...|: |.:|   .:|..|    |.:. :.|.:..:..||.
Zfish   133 GLRNAW-----NIIQAEWQCCGVTGLSDW-HEALQEKSVPDRCCQEHYTECGRNTTNVFWSQGCY 191

  Fly   161 EKVQSFYESDKLRFIIVSWVLVAFELICFALAVFL 195
            |||:.:...:|.....::..::..:|:..|.::.|
Zfish   192 EKVEEWLNDNKHLLGTIAMCVLVLQLLGMAFSMTL 226

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lbmNP_001260757.1 Tetraspannin 8..198 CDD:278750 48/224 (21%)
tetraspanin_LEL <109..169 CDD:239401 17/67 (25%)
tspan9bNP_001002186.1 Tetraspannin 8..230 CDD:278750 48/225 (21%)
NET-5_like_LEL 105..202 CDD:239418 21/102 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3882
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.