DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lbm and Tsp74F

DIOPT Version :9

Sequence 1:NP_001260757.1 Gene:lbm / 35623 FlyBaseID:FBgn0016032 Length:208 Species:Drosophila melanogaster
Sequence 2:NP_524132.1 Gene:Tsp74F / 39995 FlyBaseID:FBgn0036769 Length:236 Species:Drosophila melanogaster


Alignment Length:201 Identity:47/201 - (23%)
Similarity:83/201 - (41%) Gaps:48/201 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 IASIVLNAVLGFLAAGAIGWIAYNADTETEEFVIAAYIACSLILVFALLG--IFAAIRESVVLTA 72
            :.||:: .::.||  |.:|     |..|.:..::..:|..:|:.|..|:|  :....||.|..| 
  Fly    64 VTSIII-CLVSFL--GCVG-----AGKEVKCLLLTYFIIVALVFVTMLIGGVLGYVFRERVQQT- 119

  Fly    73 TSAVFLLILAILQIVSTCLFLHEFDVKSGRDMVEVAWQANNMDSLQQKHECCGQSSAQDYIHLSL 137
                      :.|.:.:.:.|:     ..|..:..||     |..|::.:|||..:..|:.... 
  Fly   120 ----------MRQEMRSTMALY-----GSRREITQAW-----DLTQERLQCCGVDTWHDWNRYG- 163

  Fly   138 LIPPSCYADL---QQ-------TPDHLYLDGCIEKVQSFYESDKLRFI----IVSWVLVAFELIC 188
            .:|.||..:|   |:       |..:||..||:....:|.. |....|    |...:|:.|.:| 
  Fly   164 PVPESCCQELFGGQRKECTIFPTITNLYNQGCLYVTTNFIR-DHAAVIGGTSIAVAILMIFGMI- 226

  Fly   189 FALAVF 194
            |:..:|
  Fly   227 FSCLLF 232

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lbmNP_001260757.1 Tetraspannin 8..198 CDD:278750 47/201 (23%)
tetraspanin_LEL <109..169 CDD:239401 18/69 (26%)
Tsp74FNP_524132.1 Tetraspannin 14..231 CDD:395265 46/198 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3882
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR19282
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.