Sequence 1: | NP_001260757.1 | Gene: | lbm / 35623 | FlyBaseID: | FBgn0016032 | Length: | 208 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_956702.2 | Gene: | tspan35 / 393380 | ZFINID: | ZDB-GENE-040426-1362 | Length: | 243 | Species: | Danio rerio |
Alignment Length: | 255 | Identity: | 49/255 - (19%) |
---|---|---|---|
Similarity: | 94/255 - (36%) | Gaps: | 66/255 - (25%) |
- Green bases have known domain annotations that are detailed below.
Fly 1 MGCATTSVKIASIVLNAVLGFLAAGAI---G-WIAYN-------------ADTETEEFVIAAYIA 48
Fly 49 CSL---ILVFALLGIFAAIRESVVLTATSAVFLLILAILQIVSTCLFLHEFDVKSGRDMVEVAWQ 110
Fly 111 ANNMD---SLQQKH-----------------ECCGQSSAQD-----YIHLSLLIPPSC------- 143
Fly 144 -YADLQQTPDHLYLDGCIEKVQSFYESDKLRFIIVSWVLVAFELICFALAVFLAISFKNK 202 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
lbm | NP_001260757.1 | Tetraspannin | 8..198 | CDD:278750 | 45/242 (19%) |
tetraspanin_LEL | <109..169 | CDD:239401 | 14/92 (15%) | ||
tspan35 | NP_956702.2 | Tetraspannin | 7..239 | CDD:278750 | 45/243 (19%) |
uroplakin_I_like_LEL | 116..211 | CDD:239409 | 15/99 (15%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_KOG3882 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
ZFIN | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.900 |