DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lbm and Tsp66E

DIOPT Version :9

Sequence 1:NP_001260757.1 Gene:lbm / 35623 FlyBaseID:FBgn0016032 Length:208 Species:Drosophila melanogaster
Sequence 2:NP_523985.1 Gene:Tsp66E / 39017 FlyBaseID:FBgn0035936 Length:267 Species:Drosophila melanogaster


Alignment Length:255 Identity:51/255 - (20%)
Similarity:82/255 - (32%) Gaps:82/255 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 CATTSVKIASIVLN---AVLGFLAAGAIGWIAYNAD-----------------TETEEFVIAAYI 47
            |.....|....:.|   .|||.:..|...|:|.:..                 |:.:.....||:
  Fly     5 CGVWCAKYLLCIFNFIFFVLGTIIFGVGLWLAVDKHSLIALLKLVESERIEQFTQPQAIEQLAYV 69

  Fly    48 AC---SLILVFALLGIFAAIRESVVLTATSAVFLLILAILQIVSTCL--------------FLH- 94
            ..   :::...:.||...|:|||..|.:|...||::|.|.:||:..|              ||. 
  Fly    70 LLVIGAVMFFMSFLGYLGAMRESRCLLSTYGTFLILLLIAEIVAGGLGAFFKDKVRAESKNFLQT 134

  Fly    95 ---EFDVKSGRDMVEVAWQANNMDSLQQKHECCGQSSAQDYIHL--------SLLIPPSCY---- 144
               .:.:....|...:.|     :.|.....|||.:...|:...        :..||.:|.    
  Fly   135 TITSYSLGENVDATSLMW-----NQLMGNFGCCGINDYHDFDASPAWVNGKGNRTIPDACCILKD 194

  Fly   145 --------ADLQQTP---DHLYLDGCIEKVQSFYESDKLRFIIVSWVLVAFELICFALAV 193
                    .|....|   :..|..||.|             :...|::...||:..|:||
  Fly   195 VAKLVPRDEDCTTNPSDSNSFYKKGCYE-------------VFTEWLIRQRELVIVAIAV 241

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lbmNP_001260757.1 Tetraspannin 8..198 CDD:278750 50/250 (20%)
tetraspanin_LEL <109..169 CDD:239401 15/82 (18%)
Tsp66ENP_523985.1 Tetraspannin 9..258 CDD:278750 50/251 (20%)
uroplakin_I_like_LEL 116..231 CDD:239409 20/132 (15%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45442972
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3882
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR19282
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.