DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lbm and TM4SF

DIOPT Version :9

Sequence 1:NP_001260757.1 Gene:lbm / 35623 FlyBaseID:FBgn0016032 Length:208 Species:Drosophila melanogaster
Sequence 2:NP_001261159.1 Gene:TM4SF / 37786 FlyBaseID:FBgn0020372 Length:292 Species:Drosophila melanogaster


Alignment Length:248 Identity:65/248 - (26%)
Similarity:100/248 - (40%) Gaps:69/248 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 IVLNAVLG----FLAAGAI-GWIAYNADTETEEFVIAAYIAC----SLILVF-----------AL 57
            :||.|:.|    ||....: |...|....:.:.:..||.:.|    :.||.:           .|
  Fly    18 VVLLALTGAAQIFLGTSLLWGHSVYYGIVQNKLWAPAAILLCLGPVTFILCWMGCQATNQRKRCL 82

  Fly    58 LGIFAAIRESVVLTATSAVFLLI----LAILQIVSTC--LFLH----EFDVKSGRDMVEVAWQAN 112
            ||:|||:     |.|...|..:|    ||:.:.:.|.  :|:.    ||..|..|..|:.....|
  Fly    83 LGMFAAL-----LVACICVQFIICGWSLAMRENLPTSVEIFIDDSFVEFLDKFSRTKVDNLHLWN 142

  Fly   113 NMDSLQQKHECCGQSSAQDYIHLSLLIPPSCYADLQQTPDHLYLD--------GCIEKVQSFYES 169
            .|   |.:.:|||.....||..|||  |.||.:    .|:|.|..        ||:..|.   |.
  Fly   143 RM---QSQLQCCGVDGPLDYRRLSL--PWSCCS----RPEHAYESACDTHYKRGCLAVVS---EQ 195

  Fly   170 DKLRFIIVSW---VLVAFELICFALAVFLAISF-KN----------KQRRMEF 208
            .:.|.:|.::   ::..|:.:....||.|.|.| ||          |:::.:|
  Fly   196 IRNRLLITAFGAAIIAIFQSLGIFCAVHLTILFGKNDNTHPMNMNRKKKQQQF 248

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lbmNP_001260757.1 Tetraspannin 8..198 CDD:278750 59/225 (26%)
tetraspanin_LEL <109..169 CDD:239401 20/67 (30%)
TM4SFNP_001261159.1 Tetraspannin 9..224 CDD:278750 58/222 (26%)
uroplakin_I_like_LEL 111..197 CDD:239409 28/97 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3882
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR19282
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.