DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lbm and CD82

DIOPT Version :9

Sequence 1:NP_001260757.1 Gene:lbm / 35623 FlyBaseID:FBgn0016032 Length:208 Species:Drosophila melanogaster
Sequence 2:NP_002222.1 Gene:CD82 / 3732 HGNCID:6210 Length:267 Species:Homo sapiens


Alignment Length:262 Identity:64/262 - (24%)
Similarity:102/262 - (38%) Gaps:77/262 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MGCATTSV-KIASIVLNAVLGFLAAGAIG---WIAYNAD---------TETEEFVIAAYI----- 47
            ||.|...| |....:.|.:...|.|..:|   ||.  ||         |.:....:.||:     
Human     1 MGSACIKVTKYFLFLFNLIFFILGAVILGFGVWIL--ADKSSFISVLQTSSSSLRMGAYVFIGVG 63

  Fly    48 ACSLILVFALLGIFAAIRESVVLTATSAVFLLILAILQIVSTCLFLHEF---------------- 96
            |.::::.|  ||...|:.|...|......|||::.|.|:.:..||....                
Human    64 AVTMLMGF--LGCIGAVNEVRCLLGLYFAFLLLILIAQVTAGALFYFNMGKLKQEMGGIVTELIR 126

  Fly    97 DVKSGR-DMVEVAWQANNMDSLQQKHECCGQSSAQDYIHLSLLI-------PPSCY--------- 144
            |..|.| |.::.||     |.:|.:.:|||..|..::...:.|:       |.||.         
Human   127 DYNSSREDSLQDAW-----DYVQAQVKCCGWVSFYNWTDNAELMNRPEVTYPCSCEVKGEEDNSL 186

  Fly   145 ----------ADLQQTPDH-----LYLDGCIEKVQSFYESDKLRFIIVSWVLVA-FELICFALAV 193
                      .:..|:.:|     :|.:||:||||::.: :.|..|:...|.|| .||:...|::
Human   187 SVRKGFCEAPGNRTQSGNHPEDWPVYQEGCMEKVQAWLQ-ENLGIILGVGVGVAIIELLGMVLSI 250

  Fly   194 FL 195
            .|
Human   251 CL 252

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lbmNP_001260757.1 Tetraspannin 8..198 CDD:278750 61/255 (24%)
tetraspanin_LEL <109..169 CDD:239401 20/90 (22%)
CD82NP_002222.1 Tetraspannin 24..256 CDD:278750 57/239 (24%)
CD37_CD82_like_LEL 106..229 CDD:239413 26/128 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3882
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.