DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lbm and Tsp47F

DIOPT Version :9

Sequence 1:NP_001260757.1 Gene:lbm / 35623 FlyBaseID:FBgn0016032 Length:208 Species:Drosophila melanogaster
Sequence 2:NP_725044.1 Gene:Tsp47F / 36230 FlyBaseID:FBgn0033629 Length:239 Species:Drosophila melanogaster


Alignment Length:244 Identity:62/244 - (25%)
Similarity:104/244 - (42%) Gaps:49/244 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 CATTSVKIASIVLNAV-----LGFLAAGAIGWIAYNADTETEEFVIAAYIACSLILV-------- 54
            |..:.:|......|.:     ||.|.|||:.....|   |...||....:|..::|:        
  Fly     4 CGPSLIKYVLFAFNVLFAISGLGILIAGAVVLADVN---EFNHFVEGRVLAPPIVLIVTGLIIFL 65

  Fly    55 FALLGIFAAIRESVVLTATSAVFLLILAILQI---VSTCLFLHEFD----------VKSGRDMVE 106
            .|.||.|.||:||..|..|.||.|.::.|:::   ::..:|..:.:          :|.......
  Fly    66 IASLGCFGAIKESPTLLITFAVLLAVIFIVELAVGIAASVFKKDLEGMVKNSLQESIKRSNSEDT 130

  Fly   107 VAWQANNMDSLQQKHECCGQSSAQDYIHLSL--LIPPSC----YAD-----LQQTP----DHLYL 156
            :||     |::|||..|||..|..|:..||.  .:|.||    |.|     ..::|    |..:.
  Fly   131 MAW-----DNIQQKLMCCGVDSPADWRTLSANKTLPGSCCQPQYIDSTVGHCLESPALGKDKYFQ 190

  Fly   157 DGCIEKVQSFYESDKLRFIIVSWVLVAFELICFALAVFLAISFKNKQRR 205
            .||:.|::...|.:.:..|.|...:...:::...||.:||.|.:.::.:
  Fly   191 VGCVGKLKDRIEKNAIILIGVGIGIAFIQILGIVLACYLANSIRQERAK 239

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lbmNP_001260757.1 Tetraspannin 8..198 CDD:278750 60/230 (26%)
tetraspanin_LEL <109..169 CDD:239401 22/74 (30%)
Tsp47FNP_725044.1 Tetraspannin 9..233 CDD:278750 60/231 (26%)
uroplakin_I_like_LEL 102..205 CDD:239409 26/107 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45442934
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3882
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR19282
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.