DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lbm and Tsp42Ep

DIOPT Version :9

Sequence 1:NP_001260757.1 Gene:lbm / 35623 FlyBaseID:FBgn0016032 Length:208 Species:Drosophila melanogaster
Sequence 2:NP_001260759.1 Gene:Tsp42Ep / 35626 FlyBaseID:FBgn0033137 Length:250 Species:Drosophila melanogaster


Alignment Length:222 Identity:52/222 - (23%)
Similarity:96/222 - (43%) Gaps:23/222 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 GCATTSVKIASIVLNAV-----LGFLAAGAIGWIAYNADTETEEFVIAAYIACSLILVFALLGIF 61
            ||..| :|...::.|.:     :|.::...:|......:|....:.:.:.:....|.:..:.|.:
  Fly     3 GCYNT-IKYTGLLSNLLYMLLGIGVMSGAGLGLQMAEPNTPEHTYFVKSLVLGGSICMIVMFGCY 66

  Fly    62 AAIRESVVLTATSAVFLLILAILQIVSTCLFLHEFDVKSGR------DMVEVAWQANNMD-SLQQ 119
            ..:...:.:.....:|:||    .:.:..|.||.:...|.|      ..:|:||...:.| .|..
  Fly    67 GMVANLLCVNLIFTMFILI----ALAAEYLQLHHYHSPSLRSPGGAWQQLELAWHGLDRDPELMH 127

  Fly   120 KHE----CCGQSSAQDYIHLSLLIPPSCY-ADLQQTPDHLYLDGCIEKVQSFYESDKLRFIIVSW 179
            ::|    |||.:.|.||..|.||:|.||| |.:..|...:|..||:|.:.......:.|..:..|
  Fly   128 QYEASQHCCGYNGADDYKRLHLLVPASCYQAAVNDTAQQIYPSGCLETLNRSQRYIQHRDKLYMW 192

  Fly   180 VLVAFELICFALAVFLAI-SFKNKQRR 205
            .:|..|:......|.|:: .|:.:||:
  Fly   193 AIVGLEIFILLQTVALSVLLFRLRQRQ 219

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lbmNP_001260757.1 Tetraspannin 8..198 CDD:278750 46/207 (22%)
tetraspanin_LEL <109..169 CDD:239401 23/65 (35%)
Tsp42EpNP_001260759.1 Tetraspannin <51..213 CDD:278750 41/165 (25%)
tetraspanin_LEL 91..183 CDD:239401 30/91 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45467740
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3882
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0001737
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR19282
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.840

Return to query results.
Submit another query.