DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lbm and Tsp42Eo

DIOPT Version :9

Sequence 1:NP_001260757.1 Gene:lbm / 35623 FlyBaseID:FBgn0016032 Length:208 Species:Drosophila melanogaster
Sequence 2:NP_523641.2 Gene:Tsp42Eo / 35625 FlyBaseID:FBgn0033136 Length:219 Species:Drosophila melanogaster


Alignment Length:228 Identity:64/228 - (28%)
Similarity:99/228 - (43%) Gaps:44/228 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 TSVKIASIVLNAVLGFLA--AGAIGWIAYNADT--ETEEFVIAAYIACSLILVFALLGIFAAIRE 66
            |||..:::.|  ::|.||  ||......:|..:  .||:||... :|.:|||. .|:|...||..
  Fly    11 TSVVFSTLTL--IVGVLAALAGVYELDKFNEGSAEHTEKFVQLG-MAGALILA-GLVGCLGAIFG 71

  Fly    67 SVVLTATSAVFLLILAILQIVSTCLFLHEFDVKSGRDMVEV----AWQA-----NNMDSLQQKHE 122
            |:.:...:.:.||.|    |.|....:..::.....|..||    .|..     ..|..|||::|
  Fly    72 SIKVMVVNLILLLAL----IASHIWKVSHYNETKQLDATEVYVMDLWMKELVHHGAMQDLQQEYE 132

  Fly   123 CCGQSSAQDYIHLSLLIPPSCYADLQQTPDHL-----YLDGCIEKVQ----SFYESDKLRFIIVS 178
            |||.....||..|::.:|.||:    .|.|.:     |.:||:..|:    ..|..:|       
  Fly   133 CCGDKGFSDYTSLNMKVPRSCF----HTKDGIHALYPYGEGCMAAVKRAYLQIYRYEK------- 186

  Fly   179 WV---LVAFELICFALAVFLAISFKNKQRRMEF 208
            ||   |:.:|::...|.:.|.....||.||..:
  Fly   187 WVHCGLIGYEVVGIILGITLCCQLTNKTRRYTY 219

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lbmNP_001260757.1 Tetraspannin 8..198 CDD:278750 58/214 (27%)
tetraspanin_LEL <109..169 CDD:239401 22/73 (30%)
Tsp42EoNP_523641.2 Tetraspannin 7..210 CDD:278750 60/217 (28%)
tetraspanin_LEL 110..178 CDD:239401 21/71 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3882
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0001737
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.