DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lbm and Tsp42El

DIOPT Version :9

Sequence 1:NP_001260757.1 Gene:lbm / 35623 FlyBaseID:FBgn0016032 Length:208 Species:Drosophila melanogaster
Sequence 2:NP_523638.1 Gene:Tsp42El / 35622 FlyBaseID:FBgn0033134 Length:217 Species:Drosophila melanogaster


Alignment Length:224 Identity:73/224 - (32%)
Similarity:111/224 - (49%) Gaps:23/224 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MGCATTSVKIASIVLN---AVLGFLAA--GAIGWIAYNADTETEEFVIAAYIACSLILVFALLGI 60
            |||||.::|.:..:.|   |:||.|..  |.:||.|.     .:.:.|...|....|||.:|.|.
  Fly     1 MGCATGTIKYSLFLFNALWAILGILVLIFGGLGWGAM-----PDAYAIGILILGGTILVISLFGC 60

  Fly    61 FAAIRESVVLTATSAVFLLILAILQIVSTCLFLHEFDV--KSGRDMVEVAWQ-----ANNMDSLQ 118
            ..|:|||..:..|.|..||||.:|  :...:.|:..||  |.....||..|:     ..:||.:|
  Fly    61 CGAVRESPRMLWTYASLLLILLLL--IVAFIILNPKDVFKKYALQTVENQWELEQTKPGSMDIIQ 123

  Fly   119 QKHECCGQSSAQDYIHLSL---LIPPSCYADLQ-QTPDHLYLDGCIEKVQSFYESDKLRFIIVSW 179
            :.:.|||:.|||||:.:..   .:|.||..|.. ..|.:||:.||:.||:..:..:......:.|
  Fly   124 KTYYCCGRDSAQDYLDIKFWNNTVPSSCCKDDSCVNPLNLYVRGCLIKVEEAFADEATTLGYLEW 188

  Fly   180 VLVAFELICFALAVFLAISFKNKQRRMEF 208
            .|:.|..:...||:.|||.:.|::||..:
  Fly   189 GLLGFNAVILLLAIILAIHYTNRRRRYNY 217

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lbmNP_001260757.1 Tetraspannin 8..198 CDD:278750 64/205 (31%)
tetraspanin_LEL <109..169 CDD:239401 23/68 (34%)
Tsp42ElNP_523638.1 Tetraspannin 7..196 CDD:278750 60/195 (31%)
tetraspanin_LEL 94..178 CDD:239401 28/83 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45467732
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3882
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0001737
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR19282
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.840

Return to query results.
Submit another query.