DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lbm and Tsp42Ed

DIOPT Version :9

Sequence 1:NP_001260757.1 Gene:lbm / 35623 FlyBaseID:FBgn0016032 Length:208 Species:Drosophila melanogaster
Sequence 2:NP_001286152.1 Gene:Tsp42Ed / 35613 FlyBaseID:FBgn0029507 Length:227 Species:Drosophila melanogaster


Alignment Length:221 Identity:53/221 - (23%)
Similarity:92/221 - (41%) Gaps:30/221 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 CATTSVKIASIVLNAVLGFLAAGAIGWIAYNADTETEEFVIAAYIACSLILVFALLGIFAAIRE- 66
            |....:...||:::.:..|...|       ...|.....:|...:.|.:.|| |.:|...|||| 
  Fly    22 CGILLITFGSIMVSTIKDFSGVG-------ETFTANSVAIIILVLGCVVFLV-AFMGCCGAIREN 78

  Fly    67 SVVLTATSAVFLLILAILQIVSTCLFLHEFDVKSGRD-MVEVAWQANN-----MDSLQQKHECCG 125
            |..||:.|.|.|::|.....:...:::....::...: :|:..|....     ||:||:..:|||
  Fly    79 SCALTSYSVVMLVLLVSQLALIIYVWVDHVQIQQSLEKIVQTIWDQRKTDALLMDTLQRSFKCCG 143

  Fly   126 QSSAQDYIHLSLLIPPSCYADLQQTPDH--------LYLDGCIEKVQSFYESDKLRFIIVSWVLV 182
            .:...||   .:..|.||.    .:|.:        :....|::.|.||::::..........:.
  Fly   144 LNGFADY---GITYPASCC----DSPSNGTCALTQVMTRSSCLKAVDSFWDTNVSIIKYAGLGVT 201

  Fly   183 AFELICFALAVFLAISFKNKQRRMEF 208
            |.||:.|..|..||...:|.|||..:
  Fly   202 AVELVAFIFACCLANQTRNSQRRQNY 227

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lbmNP_001260757.1 Tetraspannin 8..198 CDD:278750 48/204 (24%)
tetraspanin_LEL <109..169 CDD:239401 18/72 (25%)
Tsp42EdNP_001286152.1 Tetraspannin 8..217 CDD:278750 49/209 (23%)
tetraspanin_LEL 104..189 CDD:239401 19/91 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45467726
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3882
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0001737
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR19282
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.840

Return to query results.
Submit another query.