DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lbm and Tsp42Ec

DIOPT Version :9

Sequence 1:NP_001260757.1 Gene:lbm / 35623 FlyBaseID:FBgn0016032 Length:208 Species:Drosophila melanogaster
Sequence 2:NP_523629.1 Gene:Tsp42Ec / 35612 FlyBaseID:FBgn0033124 Length:232 Species:Drosophila melanogaster


Alignment Length:225 Identity:59/225 - (26%)
Similarity:97/225 - (43%) Gaps:44/225 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MGCATTSVKIASIVLNAVLGFLAAG----AIGWIAYN---------ADTETEEFVIAAYIACSLI 52
            |||.:..|.....::|.|  ||..|    .:|.|..:         :.|:.....|...:...||
  Fly     1 MGCLSGIVNFILYIVNIV--FLIVGILLIVLGSIMLSDLSRFDVAGSGTDPNTIPICVTVLGGLI 63

  Fly    53 LVFALLGIFAAIRESVVLTATSAVFLLILAILQIVSTC-------LFLHEFDVKSGRDMVEVAWQ 110
            .|.:..|.:...|:||.:|......:.:|.|||:|.||       .||.:..     ::|.:.|.
  Fly    64 FVVSFFGCYGIFRQSVCMTGAYTSMVFVLFILQLVLTCWVFVNRSAFLGDMS-----NLVNLLWD 123

  Fly   111 ANN---MDSLQQKHECCGQSSAQDYIHLSLLIPPSC--YADLQ---QTPDHLYLD--GCIEKVQS 165
            :::   |..|::...|||.:|..:|.::.|.:|.:|  |.|.|   .||. :|..  ||..|.:.
  Fly   124 SHDYTAMGVLEETFGCCGDTSYTNYNNIGLSVPGTCCGYLDRQATCNTPS-VYQSRPGCSAKFEE 187

  Fly   166 FYESDKLRFIIVSWV---LVAFELICFALA 192
            |:..:   ..|:.|.   |..|:|:.|.:|
  Fly   188 FWNDN---MDIIRWSGLGLCIFDLVVFLIA 214

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lbmNP_001260757.1 Tetraspannin 8..198 CDD:278750 56/218 (26%)
tetraspanin_LEL <109..169 CDD:239401 21/69 (30%)
Tsp42EcNP_523629.1 Tetraspannin 7..221 CDD:278750 56/219 (26%)
tetraspanin_LEL 104..193 CDD:239401 24/97 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45467729
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3882
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0001737
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR19282
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.840

Return to query results.
Submit another query.