DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lbm and Tsp33B

DIOPT Version :9

Sequence 1:NP_001260757.1 Gene:lbm / 35623 FlyBaseID:FBgn0016032 Length:208 Species:Drosophila melanogaster
Sequence 2:NP_523552.1 Gene:Tsp33B / 34590 FlyBaseID:FBgn0032376 Length:326 Species:Drosophila melanogaster


Alignment Length:272 Identity:49/272 - (18%)
Similarity:88/272 - (32%) Gaps:115/272 - (42%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 IVLNAVLGFLAAGAIGWIAYNADTETEEFVIAAY-----------IACSLILVFALLGIFAAIRE 66
            ::..||:|.|.                 .|:.||           |.|.|:..: |.||: ....
  Fly    16 LITEAVIGLLI-----------------LVVTAYYHTVLTGYLSDIECRLVYGY-LFGIY-VFGA 61

  Fly    67 SVVLTATSAVFL--------------LILAILQIVSTCLFLHEF----DVKSGRDMVEVA----- 108
            .||:|...::.:              |:|::....|..:....|    ::..|.|::|.|     
  Fly    62 QVVVTFLCSIAMWRRIWRRRCTPNIRLLLSVWAFYSCVIIASGFGCVWNLYRGVDVLENAADTSL 126

  Fly   109 ------------WQANNMDSLQQKHECCGQSSAQDYIH-----------LSLLIPP--------- 141
                        |:. ..|.||...||||....:|:::           .|:::.|         
  Fly   127 TRGIDMYYSCPEWKL-LWDGLQWHKECCGVHGYKDWMNAEWMPRRENNCTSMVLAPFACCKRSCD 190

  Fly   142 SCYADL-----------------QQTPDHLYLDGCIEKVQS-----FYESDKLRFIIVSWVL-VA 183
            ||:.:.                 ..|.|.:..:||:....|     ||      .::..||| :.
  Fly   191 SCFNNFLPSEGQSIGGNSRQPFPALTVDSINANGCLPAFVSAVWNCFY------ILMALWVLALK 249

  Fly   184 FELICFALAVFL 195
            |.::...:..|:
  Fly   250 FLIVLCCMTKFI 261

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lbmNP_001260757.1 Tetraspannin 8..198 CDD:278750 49/272 (18%)
tetraspanin_LEL <109..169 CDD:239401 20/101 (20%)
Tsp33BNP_523552.1 Tetraspannin 20..256 CDD:278750 48/261 (18%)
CD151_like_LEL 112..237 CDD:239408 22/125 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45442988
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3882
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR19282
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.930

Return to query results.
Submit another query.