DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lbm and Tsp29Fb

DIOPT Version :9

Sequence 1:NP_001260757.1 Gene:lbm / 35623 FlyBaseID:FBgn0016032 Length:208 Species:Drosophila melanogaster
Sequence 2:NP_001137809.1 Gene:Tsp29Fb / 34212 FlyBaseID:FBgn0032075 Length:308 Species:Drosophila melanogaster


Alignment Length:252 Identity:59/252 - (23%)
Similarity:98/252 - (38%) Gaps:57/252 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MGCATTSVKIASIV--LNAVLGFLAAGAIGWIAYNADTETEEFVI----------AAYIACSLIL 53
            |.||...:.|.|.:  |.|:|..:....|       .|...:|.:          |..||...||
  Fly    12 MKCAKYMLIIVSFMFALTAILLIMVGTTI-------QTIFGDFSLFIDGHFSSPPALLIAIGFIL 69

  Fly    54 V-FALLGIFAAIRESVVLTATSAVFLLILAILQI-VSTCLFLHEFDVKSGRDMVEVAWQA----- 111
            : .|.||.:.|::|||::.....|.|.::.||:: .:...|:.:..|:.  .::....||     
  Fly    70 IAVAALGAYGAVKESVMVINLYGVCLFLVFILEVSAAIAAFVMQSQVRG--MLIRTMNQALAEYE 132

  Fly   112 ------NNMDSLQQKHECCGQSSAQDY-------IHLSL-----LIPPSCYAD--------LQQT 150
                  :.:|.:|...||||.:..:|:       ::.:|     ::|.||..:        .|.|
  Fly   133 HDPYVESGVDFMQSMLECCGVNEPEDWKDYLSANVNFTLGVDDVVVPNSCCGNQPTSLNDSTQMT 197

  Fly   151 PDHLYLDGCIEKVQSFYESDKLRFIIVSWVLVAFELICFALAVFLAISF--KNKQRR 205
            ....|..||..|: :|..|.....|......|||..:...|..|:....  :||..|
  Fly   198 CMETYDYGCFRKM-NFIVSQSAMLIATGATTVAFVQLLGVLCAFMLAKTLRRNKSIR 253

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lbmNP_001260757.1 Tetraspannin 8..198 CDD:278750 53/234 (23%)
tetraspanin_LEL <109..169 CDD:239401 20/90 (22%)
Tsp29FbNP_001137809.1 Tetraspannin 14..246 CDD:278750 55/241 (23%)
tetraspanin_LEL 110..218 CDD:239401 23/110 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3882
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR19282
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.