DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lbm and Tsp5D

DIOPT Version :9

Sequence 1:NP_001260757.1 Gene:lbm / 35623 FlyBaseID:FBgn0016032 Length:208 Species:Drosophila melanogaster
Sequence 2:NP_001259266.1 Gene:Tsp5D / 31540 FlyBaseID:FBgn0029837 Length:287 Species:Drosophila melanogaster


Alignment Length:258 Identity:56/258 - (21%)
Similarity:94/258 - (36%) Gaps:93/258 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 GCATTSVKIASIVLNAVLGFLAAGAIGWIAYNADTETEEFVIAAYIACSLILVFALLGIFAAIRE 66
            |.||...:.|.:..:.:  |:..|..|            ||::.:..|         |.:...| 
  Fly    40 GYATLLPQHAGLSADTI--FMGIGGTG------------FVVSFFGCC---------GAWVQSR- 80

  Fly    67 SVVLTATSAVFLLILAILQIVSTCLFLHEFDVKS---------GRDM-------VEVAWQANN-- 113
                      .||:|..:.||  .||:.||.|.|         ||.:       :|..:.:::  
  Fly    81 ----------CLLVLYFMLIV--MLFMSEFLVGSIAFLFRGGLGRTLANELRFGIERHYNSSDRG 133

  Fly   114 ----------MDSLQQKHECCGQSSAQDYIHLS-----LLIPPSC--------------YADLQQ 149
                      .||:||..||||.||.:|:..:.     ..:|.||              ..|...
  Fly   134 SLVAPSVASIWDSVQQSFECCGVSSYEDWYDIQSWPGRRWVPESCCRTLYDQRQVLTEGSGDGMM 198

  Fly   150 TPD-------HLYLD-GCIEKVQSFYESDKLRFIIVSWVLVAF-ELICFALAVFLAISFKNKQ 203
            .||       .|:.| ||...:||:: :.:|..:....:.:|| :|.....::.|..:.|:|:
  Fly   199 RPDCGRSENPSLWWDKGCAHSLQSWF-TGQLNVVGAVGLGIAFVQLFGLITSMLLFCTVKHKR 260

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lbmNP_001260757.1 Tetraspannin 8..198 CDD:278750 51/245 (21%)
tetraspanin_LEL <109..169 CDD:239401 23/98 (23%)
Tsp5DNP_001259266.1 Tetraspannin 8..256 CDD:278750 54/252 (21%)
NET-5_like_LEL 105..228 CDD:239418 26/123 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3882
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR19282
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.