DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lbm and Tspan9

DIOPT Version :9

Sequence 1:NP_001260757.1 Gene:lbm / 35623 FlyBaseID:FBgn0016032 Length:208 Species:Drosophila melanogaster
Sequence 2:NP_001101360.1 Gene:Tspan9 / 312728 RGDID:1304740 Length:330 Species:Rattus norvegicus


Alignment Length:232 Identity:51/232 - (21%)
Similarity:98/232 - (42%) Gaps:52/232 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 GCATTSVKIASIVLNAVLGFLAAGAIG---WIAY---NADTETEEF--VIAAYIAC---SLILVF 55
            || ...:|....:.|.:......|.:|   |::.   |..|.:..|  :.||.:..   ::::|.
  Rat    95 GC-LCCLKYMMFLFNLIFWLCGCGLLGVGIWLSVSQGNFATFSPSFPSLSAANLVIAIGTIVMVT 158

  Fly    56 ALLGIFAAIRESVVLTATSAVFLLILAILQIVSTCLFL---------HEFDVKSGRDM------- 104
            ..||...||:|:..|..:..:.|||:.:.:::...||.         .:.|:|.|..:       
  Rat   159 GFLGCLGAIKENKCLLLSFFIVLLIILLAELILLILFFVYMDKVNENAKQDLKEGLLLYNTENNV 223

  Fly   105 -VEVAWQANNMDSLQQKHECCGQSSAQDYIHL--SLLIPPSCYADLQQ-------TPDHLYLDGC 159
             ::.||     :.:|.:..|||.:...|:..:  ...:|..|..:..|       ||  |:..||
  Rat   224 GLKNAW-----NIIQAEMRCCGVTDYTDWYPVLGENTVPDRCCMENSQGCGRNSTTP--LWKTGC 281

  Fly   160 IEKVQSFYESDK-------LRFIIVSWVLVAFELICF 189
            .|||:.:::.:|       :.|:|:..:.:||.:..|
  Rat   282 YEKVKLWFDDNKHVLGTVGMCFLIMQILGMAFSMTLF 318

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lbmNP_001260757.1 Tetraspannin 8..198 CDD:278750 49/226 (22%)
tetraspanin_LEL <109..169 CDD:239401 17/68 (25%)
Tspan9NP_001101360.1 Tetraspannin 100..317 CDD:395265 48/223 (22%)
NET-5_like_LEL 196..293 CDD:239418 21/103 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.