DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lbm and Rom1

DIOPT Version :10

Sequence 1:NP_523639.1 Gene:lbm / 35623 FlyBaseID:FBgn0016032 Length:208 Species:Drosophila melanogaster
Sequence 2:NP_001009690.1 Gene:Rom1 / 309201 RGDID:1306070 Length:351 Species:Rattus norvegicus


Alignment Length:55 Identity:17/55 - (30%)
Similarity:26/55 - (47%) Gaps:12/55 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   114 MDSLQQKHECCGQSSAQDYIHLSLLIPPSCYAD---------LQQTPDHLYL-DG 158
            ||.||.::.|||:...:|:..:..:  .|.|.|         :|...:.||| ||
  Rat   159 MDELQLRYHCCGRHGYKDWFGVQWV--SSRYLDPNDQDVVDRIQSNVEGLYLIDG 211

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lbmNP_523639.1 Tetraspanin <47..196 CDD:459767 17/55 (31%)
tetraspanin_LEL <109..169 CDD:239401 17/55 (31%)
Rom1NP_001009690.1 peripherin_like_LEL 128..264 CDD:239415 17/55 (31%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 329..351
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.