DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lbm and Tspan1

DIOPT Version :9

Sequence 1:NP_001260757.1 Gene:lbm / 35623 FlyBaseID:FBgn0016032 Length:208 Species:Drosophila melanogaster
Sequence 2:NP_001004236.1 Gene:Tspan1 / 298436 RGDID:1303308 Length:241 Species:Rattus norvegicus


Alignment Length:243 Identity:48/243 - (19%)
Similarity:98/243 - (40%) Gaps:58/243 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 VKIASIVLNAVLGFLAAG--AIG-WIAYNA----------DTETEEFVIAAYI---ACSLILVFA 56
            :|:..|:.|.::....|.  |:| |::.:.          .:...:||...|.   |.:::.:..
  Rat     7 IKVMMILFNLLIFLCGAALLAVGIWVSVDGTSFLKAFGSLSSSAMQFVNVGYFLIAAGAVLFILG 71

  Fly    57 LLGIFAAIRES-VVLTATSAVFLLIL------AILQIVSTCL---FLH-------EFDVKSGRDM 104
            .||.:.|..|: .||....::.|:|.      |::.:|.|.:   ||.       |.|.....:.
  Rat    72 FLGCYGAHSENKCVLMMFFSILLIIFIAEIAGAVVALVYTTMAEQFLTFLVVPAIEKDYGYQTEF 136

  Fly   105 VEVAWQANNMDSLQQKHECCGQSSAQD-----YIHLSLLIPPSCYADLQQTPDH----------- 153
            .:| |. :.|:.|    .|||.::..|     ::..:.:.||.|.|:  .|..|           
  Rat   137 TQV-WN-STMEGL----HCCGFNNYTDFNSSRFVKENKVFPPFCCAN--NTDSHTVEPCTEDKAK 193

  Fly   154 -LYLDGCIEKVQSFYESDKLRFIIVSWVLVAFELICFALAVFLAISFK 200
             :.:.||.:::.....::.:....|:..:.|.||....::::|..:.|
  Rat   194 SMNVQGCFKQILQKIRTNAVTVGGVAVGVAALELAAMVVSMYLYCNLK 241

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lbmNP_001260757.1 Tetraspannin 8..198 CDD:278750 47/239 (20%)
tetraspanin_LEL <109..169 CDD:239401 15/76 (20%)
Tspan1NP_001004236.1 Tetraspannin 7..236 CDD:395265 46/236 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3882
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.