DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lbm and Cd37

DIOPT Version :9

Sequence 1:NP_001260757.1 Gene:lbm / 35623 FlyBaseID:FBgn0016032 Length:208 Species:Drosophila melanogaster
Sequence 2:XP_017444339.1 Gene:Cd37 / 29185 RGDID:62035 Length:396 Species:Rattus norvegicus


Alignment Length:278 Identity:54/278 - (19%)
Similarity:90/278 - (32%) Gaps:96/278 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 VKIASIVLNAVLGFLAAGAI----GWIAYNADTETEEFVIAAYIACS-----------LILVFAL 57
            :|....|.| :..|:..|.|    .||..: .|....||..:::...           |.:..||
  Rat    34 IKYFLFVFN-LFFFVLGGLIFCFGTWILID-KTSFVSFVGLSFVPLQTWSKVLSVSGVLTMALAL 96

  Fly    58 LGIFAAIRESVVLTATSAVFLLILAILQIVSTCLF------------------LHEFDVKSGRDM 104
            ||...|::|...|.......||:|...||....|.                  :..:........
  Rat    97 LGCVGALKELRCLLGLYFGMLLLLFATQITLGILISTQRVRLERRVQELVLRTIQSYRTNPDETA 161

  Fly   105 VEVAWQANNMDSLQQKHECCGQSSAQDYIHLSLL---------IPPSCY---------------- 144
            .|.:|     |..|.:..|||..|.:|:....:|         :|.|||                
  Rat   162 AEESW-----DYAQFQLRCCGWQSPRDWNKAQMLKANGSEELFVPCSCYNSTATNDSSGFDKLFL 221

  Fly   145 ---------ADLQQTPD--------HLYLDGCIEKVQSFYESDKLRFIIVSWVLVAFELICFALA 192
                     |.|:||.|        |:|.:||...:|.:..::          :::...||..:.
  Rat   222 SQLSRLGPRAKLRQTADICALPAKAHIYREGCARSLQKWLHNN----------IISIVGICLGVG 276

  Fly   193 VF----LAISFKNKQRRM 206
            :.    :|:..:.::|.|
  Rat   277 LLEVSGMALCLQLQRRAM 294

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lbmNP_001260757.1 Tetraspannin 8..198 CDD:278750 52/268 (19%)
tetraspanin_LEL <109..169 CDD:239401 23/101 (23%)
Cd37XP_017444339.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3882
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.