DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lbm and TSPAN16

DIOPT Version :9

Sequence 1:NP_001260757.1 Gene:lbm / 35623 FlyBaseID:FBgn0016032 Length:208 Species:Drosophila melanogaster
Sequence 2:NP_036598.1 Gene:TSPAN16 / 26526 HGNCID:30725 Length:245 Species:Homo sapiens


Alignment Length:188 Identity:41/188 - (21%)
Similarity:64/188 - (34%) Gaps:57/188 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MGCATTSVKIASIVLNAVLGFLAAGAIGWIAYNADTETEEFVIAAYIACSLILVFALLGIFAAIR 65
            |||.|                :..|..||  |.|..|:.    ...:.|.|.:|..|        
Human    64 MGCIT----------------VLLGCAGW--YGATKESR----GTLLFCILSMVIVL-------- 98

  Fly    66 ESVVLTATSAVFLLILAILQIVSTCLFLHEFDV--KSGRDMVEVAWQANNMDSLQQKHECCGQSS 128
               ::..|:|.  ::|....||......|.|..  |:.|...|....:...:.:.:|.:|||.::
Human    99 ---IMEVTAAT--VVLLFFPIVGDVALEHTFVTLRKNYRGYNEPDDYSTQWNLVMEKLKCCGVNN 158

  Fly   129 AQDYIHLSL------LIPPSCYADL--------QQTPDHLYLDGC------IEKVQSF 166
            ..|:...|.      ..|.||...:        ..:|:.::..||      |.|.|||
Human   159 YTDFSGSSFEMTTGHTYPRSCCKSIGSVSCDGRDVSPNVIHQKGCFHKLLKITKTQSF 216

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lbmNP_001260757.1 Tetraspannin 8..198 CDD:278750 37/181 (20%)
tetraspanin_LEL <109..169 CDD:239401 17/78 (22%)
TSPAN16NP_036598.1 Tetraspannin 19..232 CDD:278750 41/188 (22%)
uroplakin_I_like_LEL 120..215 CDD:239409 19/94 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3882
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.