DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lbm and tsp-21

DIOPT Version :9

Sequence 1:NP_001260757.1 Gene:lbm / 35623 FlyBaseID:FBgn0016032 Length:208 Species:Drosophila melanogaster
Sequence 2:NP_001370185.1 Gene:tsp-21 / 259720 WormBaseID:WBGene00023491 Length:301 Species:Caenorhabditis elegans


Alignment Length:247 Identity:59/247 - (23%)
Similarity:98/247 - (39%) Gaps:75/247 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 FLAAG----AIGWIAYNADTETEEFVIAAYIACSL--ILVFALLGIFAAI----------RESVV 69
            ||.:|    .:|...|::.....|....:|.|.|.  :.||..:.||..:          .:|::
 Worm    24 FLISGLSSLIVGVWLYSSKNNFIELTPTSYSALSAAGLCVFTGVTIFIIVAVGYLGVSWSNKSLL 88

  Fly    70 LTATSAVFLLIL--AILQIVSTCLFLHEFDVKS-------------------GRDM-VEVAWQAN 112
            .:....|.||||  .|.:|..:   ||:.:.|.                   ||:: :.:.|   
 Worm    89 YSYIGFVILLILVHGIARITGS---LHKEEAKENLRKSMLHNINTTAVVTKIGREIKLSLTW--- 147

  Fly   113 NMDSLQQKHECCGQSSAQDY---IHL--SLLIPPSC----YADLQ-------QTPDH---LYLDG 158
              |.||::.:|||..:..|:   :|.  :|..|.||    :.|.:       :.||.   ||..|
 Worm   148 --DHLQRELQCCGVDNYTDWHYSVHWPNNLYTPDSCCDPQHFDAENGTENCGKLPDEQSLLYQKG 210

  Fly   159 CIEKVQSFYESDKL--RFIIVSWV---LVAFELICFALAVFLAISFKNKQRR 205
            |..|.     ||.|  ..|:|:||   |...|::...|::.:....||.:.:
 Worm   211 CFPKF-----SDWLYHHIILVNWVTSILFVVEILLLILSLVVLRVLKNSRHK 257

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lbmNP_001260757.1 Tetraspannin 8..198 CDD:278750 57/238 (24%)
tetraspanin_LEL <109..169 CDD:239401 21/78 (27%)
tsp-21NP_001370185.1 CD151_like_LEL 106..223 CDD:239408 30/129 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3882
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.