DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lbm and CG30160

DIOPT Version :9

Sequence 1:NP_001260757.1 Gene:lbm / 35623 FlyBaseID:FBgn0016032 Length:208 Species:Drosophila melanogaster
Sequence 2:NP_724526.1 Gene:CG30160 / 246490 FlyBaseID:FBgn0050160 Length:222 Species:Drosophila melanogaster


Alignment Length:237 Identity:64/237 - (27%)
Similarity:98/237 - (41%) Gaps:50/237 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MGCATTSVKIASIVLNAVLGFLAAGAI-------------GWIAYNADTETEEFVIAAYIACSLI 52
            |.|.:...|....:||.|  |:|.|.:             .:.|::....|:...|...:..|:.
  Fly     1 MNCLSAMFKYLLYLLNLV--FVAGGILLIVVGSIMLSTMGNFTAFDGGVNTQTIPICIIVIGSVT 63

  Fly    53 LVFALLGIFAAIRESVVLTATSAVFLLILAILQI-VSTCLFL--HEFDVKSGRDMVEVAWQANN- 113
            .|.|..|....|||:...|...|:.:|||..||: :|..:|.  .:|....|: .|:.||..|| 
  Fly    64 FVVAFFGCCGTIRENACCTTIYAICMLILFGLQLALSIWIFAANDKFLSSMGK-AVDKAWDENNA 127

  Fly   114 -----MDSLQQKHECCGQSSAQDYIHLSLLIPPSC--YAD---------LQQTPDHLYLDGCIEK 162
                 ||:||....|||.:..|.|    ..:|.||  |.|         ..|.|      ||.::
  Fly   128 AQGYPMDALQLAFSCCGNTGYQQY----ETVPSSCCGYKDRTKVCEAEIYSQRP------GCRQE 182

  Fly   163 VQSFYES--DKLRFIIVSWVLVAFELICFALAVFLAISFKNK 202
            ...|:.|  |.:|:  .|.::..|||..|.::..||.:.:.:
  Fly   183 FVDFWASNTDLIRW--SSLIIALFELGIFIMSCCLASAMRKR 222

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lbmNP_001260757.1 Tetraspannin 8..198 CDD:278750 62/224 (28%)
tetraspanin_LEL <109..169 CDD:239401 22/76 (29%)
CG30160NP_724526.1 Tetraspannin 8..219 CDD:278750 62/225 (28%)
tetraspanin_LEL 104..191 CDD:239401 28/97 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45467733
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3882
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0001737
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR19282
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.840

Return to query results.
Submit another query.