DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lbm and TSPAN19

DIOPT Version :9

Sequence 1:NP_001260757.1 Gene:lbm / 35623 FlyBaseID:FBgn0016032 Length:208 Species:Drosophila melanogaster
Sequence 2:NP_001094387.1 Gene:TSPAN19 / 144448 HGNCID:31886 Length:248 Species:Homo sapiens


Alignment Length:226 Identity:55/226 - (24%)
Similarity:92/226 - (40%) Gaps:48/226 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 VLGFLAAGAIGWIAYN------ADTETEEFVIAAYIACSLI------LVFALLGIFAAIRESVVL 70
            |||.|..|...|:..:      |..|...|::.  |:..||      ::|.|||......|...|
Human    23 VLGLLFMGFGAWLLLDRNNFLTAFDENNHFIVP--ISQILIGMGSSTVLFCLLGYIGIHNEIRWL 85

  Fly    71 TATSAVFLLILAILQIVSTCLFL----------H---EFDVK--SGRDMVEVAWQANNMDSLQQK 120
            ....||.:.....:|:|.:...:          |   :|.:.  ..:|..|...:...:::||:.
Human    86 LIVYAVLITWTFAVQVVLSAFIITKKEEVQQLWHDKIDFVISEYGSKDKPEDITKWTILNALQKT 150

  Fly   121 HECCGQSSAQDYI-----HLSLLIPPSC--------YAD--LQQTPDHLYLDGCIEKVQSFYESD 170
            .:||||.:..|:|     ..|..:|.||        :.|  |..|    ||:||..|:.::|..:
Human   151 LQCCGQHNYTDWIKNKNKENSGQVPCSCTKSTLRKWFCDEPLNAT----YLEGCENKISAWYNVN 211

  Fly   171 KLRFIIVSWVLVAFELICFALAVFLAISFKN 201
            .|..|.:::.|:..|:...:|.|....:.||
Human   212 VLTLIGINFGLLTSEVFQVSLTVCFFKNIKN 242

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lbmNP_001260757.1 Tetraspannin 8..198 CDD:278750 53/221 (24%)
tetraspanin_LEL <109..169 CDD:239401 21/74 (28%)
TSPAN19NP_001094387.1 Tetraspannin 9..240 CDD:278750 53/222 (24%)
CD37_CD82_like_LEL 107..212 CDD:239413 25/108 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3882
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.