DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lbm and Cd53

DIOPT Version :9

Sequence 1:NP_001260757.1 Gene:lbm / 35623 FlyBaseID:FBgn0016032 Length:208 Species:Drosophila melanogaster
Sequence 2:NP_031677.1 Gene:Cd53 / 12508 MGIID:88341 Length:219 Species:Mus musculus


Alignment Length:219 Identity:54/219 - (24%)
Similarity:86/219 - (39%) Gaps:61/219 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 GCATTSVKIASIVLNAV------LGFLAAGAIGWIAYNADTETEEFVIAAYIACSLILVFALLGI 60
            ||......|..:|.|..      |.||..|.|                 ..|..|:|:|.|.||.
Mouse    24 GCCILGFGIYFLVQNTYGVLFRNLPFLTLGNI-----------------LVIVGSIIMVVAFLGC 71

  Fly    61 FAAIRESVVLTATSAVFLLILAILQI-VSTCLFLHEFD----VKSG-RDMVE---------VAWQ 110
            ..:|:|:..|..:..|.|||:.:.:: ::..||::|..    |..| .|.::         .|| 
Mouse    72 MGSIKENKCLLMSFFVLLLIILLAEVTIAILLFVYEQKLNTLVAEGLNDSIQHYHSDNSTMKAW- 135

  Fly   111 ANNMDSLQQKHECCGQSSAQDYIHLSLLIPPSCYADLQQTPDHLYLDGCIEKVQSFYESDKLRFI 175
                |.:|.:.:|||.:.:.|:....   |.||       |....:.||..|.:|::.|:.|...
Mouse   136 ----DFIQTQLQCCGVNGSSDWTSGP---PSSC-------PSGADVQGCYNKAKSWFHSNFLYIG 186

  Fly   176 IVSWVLVAFELICFALAVFLAISF 199
            |::        ||..:...|.:||
Mouse   187 IIT--------ICVCVIQVLGMSF 202

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lbmNP_001260757.1 Tetraspannin 8..198 CDD:278750 50/210 (24%)
tetraspanin_LEL <109..169 CDD:239401 15/59 (25%)
Cd53NP_031677.1 Tetraspannin 9..210 CDD:278750 54/219 (25%)
CD53_like_LEL 104..186 CDD:239417 23/96 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3882
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.