DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lbm and Cd37

DIOPT Version :9

Sequence 1:NP_001260757.1 Gene:lbm / 35623 FlyBaseID:FBgn0016032 Length:208 Species:Drosophila melanogaster
Sequence 2:XP_006540655.1 Gene:Cd37 / 12493 MGIID:88330 Length:396 Species:Mus musculus


Alignment Length:273 Identity:56/273 - (20%)
Similarity:89/273 - (32%) Gaps:89/273 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 VKIASIVLNAVLGFLAAGAI----GWIAYNADTETEEFVIAAYIACS-----------LILVFAL 57
            :|....|.| :..|:..|.|    .||..: .|....||..:::...           |.:..||
Mouse    33 IKYFLFVFN-LFFFVLGGLIFCFGTWILID-KTSFVSFVGLSFVPLQTWSKVLAVSGVLTMALAL 95

  Fly    58 LGIFAAIRESVVLTATSAVFLLILAILQIVSTCLF------------------LHEFDVKSGRDM 104
            ||...|::|...|.......||:|...||....|.                  :..:........
Mouse    96 LGCVGALKELRCLLGLYFGMLLLLFATQITLGILISTQRVRLERRVQELVLRTIQSYRTNPDETA 160

  Fly   105 VEVAWQANNMDSLQQKHECCGQSSAQDYIHLSLL---------IPPSCY---------------- 144
            .|.:|     |..|.:..|||..|.:|:....:|         :|.|||                
Mouse   161 AEESW-----DYAQFQLRCCGWQSPRDWNKAQMLKANESEEPFVPCSCYNSTATNDSTVFDKLFF 220

  Fly   145 ---------ADLQQTPD--------HLYLDGCIEKVQSFYESDKLRFIIVSWVLVAFELICFALA 192
                     |.|:||.|        |:|.:||.:.:|.:..::.:..:.:...:...|:...||.
Mouse   221 SQLSRLGPRAKLRQTADICALPAKAHIYREGCAQSLQKWLHNNIISIVGICLGVGLLEVSGMALC 285

  Fly   193 VFLAISFKNKQRR 205
            :.|       |||
Mouse   286 LQL-------QRR 291

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lbmNP_001260757.1 Tetraspannin 8..198 CDD:278750 53/264 (20%)
tetraspanin_LEL <109..169 CDD:239401 23/101 (23%)
Cd37XP_006540655.1 CD37_CD82_like_LEL 130..265 CDD:239413 24/139 (17%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3882
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.