DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lbm and TSPAN9

DIOPT Version :9

Sequence 1:NP_001260757.1 Gene:lbm / 35623 FlyBaseID:FBgn0016032 Length:208 Species:Drosophila melanogaster
Sequence 2:NP_001161792.1 Gene:TSPAN9 / 10867 HGNCID:21640 Length:239 Species:Homo sapiens


Alignment Length:236 Identity:49/236 - (20%)
Similarity:103/236 - (43%) Gaps:37/236 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 GCATTSVKIASIVLNAVLGFLAAGAIG---WIAY---NADTETEEF--VIAAYIAC---SLILVF 55
            || ...:|....:.|.:......|.:|   |::.   |..|.:..|  :.||.:..   ::::|.
Human     4 GC-LCCLKYMMFLFNLIFWLCGCGLLGVGIWLSVSQGNFATFSPSFPSLSAANLVIAIGTIVMVT 67

  Fly    56 ALLGIFAAIRESVVLTATSAVFLLILAILQIVSTCLF---LHEFDVKSGRDMVE---VAWQANNM 114
            ..||...||:|:..|..:..:.||::.:.:::...||   :.:.:..:.:|:.|   :....||:
Human    68 GFLGCLGAIKENKCLLLSFFIVLLVILLAELILLILFFVYMDKVNENAKKDLKEGLLLYHTENNV 132

  Fly   115 ------DSLQQKHECCGQSSAQDYIHL--SLLIPPSCYADLQQ-------TPDHLYLDGCIEKVQ 164
                  :.:|.:..|||.:...|:..:  ...:|..|..:..|       ||  |:..||.|||:
Human   133 GLKNAWNIIQAEMRCCGVTDYTDWYPVLGENTVPDRCCMENSQGCGRNATTP--LWRTGCYEKVK 195

  Fly   165 SFYESDKLRFIIVSWVLVAFELI--CFALAVFLAISFKNKQ 203
            .:::.:|.....|...::..:::  .|::.:|..|....|:
Human   196 MWFDDNKHVLGTVGMCILIMQILGMAFSMTLFQHIHRTGKK 236

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lbmNP_001260757.1 Tetraspannin 8..198 CDD:278750 45/223 (20%)
tetraspanin_LEL <109..169 CDD:239401 18/74 (24%)
TSPAN9NP_001161792.1 Tetraspannin 9..226 CDD:395265 44/218 (20%)
NET-5_like_LEL 105..202 CDD:239418 20/98 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3882
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.